Protein Info for AO353_07785 in Pseudomonas fluorescens FW300-N2E3
Updated annotation (from data): ABC transporter for Carnitine, permease component
Rationale: Specific phenotypes on Carnitine Hydrochloride. no phenotype in choline stress; annotated as glycine betaine or proline transport. Another issue is that carnitine might be oxidized to choline which is then excreted (MetaCyc Pathway: L-carnitine degradation II) but this would not support growth with carnitine as either C or N source (no C or N extracted). Note that both carnitine and choline are catabolized via glycine betaine and this is clustered with glycine betaine degradation genes. This ABC transporter might also transport choline or glycine betaine with a different SBP (AO353_07780).
Original annotation: choline ABC transporter permease subunit
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 44% identical to OPUAB_BACSU: Glycine betaine transport system permease protein OpuAB (opuAB) from Bacillus subtilis (strain 168)
KEGG orthology group: K02001, glycine betaine/proline transport system permease protein (inferred from 96% identity to pfl:PFL_5763)Predicted SEED Role
"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0N7GZQ0 at UniProt or InterPro
Protein Sequence (281 amino acids)
>AO353_07785 ABC transporter for Carnitine, permease component (Pseudomonas fluorescens FW300-N2E3) MLIDQKIPLGQYIAAFVEWLTQHGASTFDAIATTLETMIHGVTFALTWFNPLALIGLIAL LAHFIQRKWGLTAFVIASFLLILNLGYWQETMETLAQVLFATFVCVIIGVPLGIVAAHKP MFYTMMRPVLDLMQTVPTFVYLIPTLTLFGLGVVPGLISTVVFAIAAPIRLTYLGIRDVP QELMDAGKAFGCSRRQLLSRIELPHAMPSIAAGITQCIMLSLSMVVIAALVGADGLGKPV VNALNTADIALGFEAGLAIVLLAIMLDRICKQPDAKVGGDA