Protein Info for AO353_07755 in Pseudomonas fluorescens FW300-N2E3

Updated annotation (from data): betainyl-CoA thiolase (EC 3.1.2.-)
Rationale: Specifically important for: Carnitine Hydrochloride. This is part of the degradation of carnitine (K. Bastard et al, Nature Chem Biol. 2014). Since KEGG had this EC number you could argue that it is correct, but it made a very vague prediction.
Original annotation: 4-hydroxybenzoyl-CoA thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 PF13279: 4HBT_2" amino acids 13 to 132 (120 residues), 95.6 bits, see alignment E=3e-31 PF03061: 4HBT" amino acids 37 to 89 (53 residues), 23.2 bits, see alignment E=7.1e-09

Best Hits

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 84% identity to pfo:Pfl01_5233)

MetaCyc: 67% identical to betainyl-CoA thioesterase (Pseudomonas aeruginosa PAO1)
3.1.2.M6 [EC: 3.1.2.M6]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.- or 3.1.2.M6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WGA2 at UniProt or InterPro

Protein Sequence (158 amino acids)

>AO353_07755 betainyl-CoA thiolase (EC 3.1.2.-) (Pseudomonas fluorescens FW300-N2E3)
MPALTTYTTKIIPDWVDYNGHLRDAFYLLIFSYATDALMDQLGMDSNNREASGNSLFTLE
LHLNYLHEVKLGAEVEVHTQIIGHDRKRLHLYHSLHLVGEEQELAGNEQMLLHVDLAGPR
SAPFSESVLNKLRAMSALQSDLPTPAYIGRVIALPPEK