Protein Info for AO353_07755 in Pseudomonas fluorescens FW300-N2E3

Updated annotation (from data): betainyl-CoA thiolase (EC 3.1.2.-)
Rationale: Specifically important for: Carnitine Hydrochloride. This is part of the degradation of carnitine (K. Bastard et al, Nature Chem Biol. 2014). Since KEGG had this EC number you could argue that it is correct, but it made a very vague prediction.
Original annotation: 4-hydroxybenzoyl-CoA thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13279: 4HBT_2
  • amino acids 13 to 132 (120 residues), 95.6 bits, E=3e-31
• PF03061: 4HBT
  • amino acids 37 to 89 (53 residues), 23.2 bits, E=7.1e-09

Best Hits

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 84% identity to pfo:Pfl01_5233)

MetaCyc: 67% identical to betainyl-CoA thioesterase (Pseudomonas aeruginosa PAO1)
3.1.2.M6 [EC: 3.1.2.M6]

Predicted SEED Role

No annotation

MetaCyc Pathways

• L-carnitine degradation III (3/3 steps found)
• D-carnitine degradation I (2/3 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.- or 3.1.2.M6

Sequence Analysis Tools

See A0A0N9WGA2 at UniProt or InterPro

Protein Sequence (158 amino acids)

>AO353_07755 betainyl-CoA thiolase (EC 3.1.2.-) (Pseudomonas fluorescens FW300-N2E3)
MPALTTYTTKIIPDWVDYNGHLRDAFYLLIFSYATDALMDQLGMDSNNREASGNSLFTLE
LHLNYLHEVKLGAEVEVHTQIIGHDRKRLHLYHSLHLVGEEQELAGNEQMLLHVDLAGPR
SAPFSESVLNKLRAMSALQSDLPTPAYIGRVIALPPEK