Protein Info for AO353_07750 in Pseudomonas fluorescens FW300-N2E3

Updated annotation (from data): carnitine 3-dehydrogenase [EC:1.1.1.108]
Rationale: Specifically important for: Carnitine Hydrochloride. Not sure why SEED missed this: some very similar proteins are annotated correctly. pba:PSEBR_a5237 has been updated in KEGG and is now annotated as the carnitine dehydrogenase. (KEGG_correct)
Original annotation: 3-hydroxybutyryl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF02737: 3HCDH_N" amino acids 11 to 184 (174 residues), 136.1 bits, see alignment E=1.3e-43 PF00725: 3HCDH" amino acids 188 to 264 (77 residues), 55.3 bits, see alignment E=7.9e-19

Best Hits

Swiss-Prot: 92% identical to LCDH_PSEU2: L-carnitine dehydrogenase (lcdH) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K00074, 3-hydroxybutyryl-CoA dehydrogenase [EC: 1.1.1.157] (inferred from 97% identity to pba:PSEBR_a5237)

MetaCyc: 85% identical to L-carnitine dehydrogenase (Pseudomonas aeruginosa PAO1)
Carnitine 3-dehydrogenase. [EC: 1.1.1.108]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.157

Use Curated BLAST to search for 1.1.1.108 or 1.1.1.157

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VS13 at UniProt or InterPro

Protein Sequence (321 amino acids)

>AO353_07750 carnitine 3-dehydrogenase [EC:1.1.1.108] (Pseudomonas fluorescens FW300-N2E3)
MSFITEIKTFAALGSGVIGSGWVSRALAHGLDVVAWDPAPGAEVALRKRVANAWGALEKQ
GLAPGASQDRLRFVATIEECVRDADFIQESAPERLELKLELHSKISAAAKPNALIGSSTS
GLLPSEFYEGSTHPERCVVGHPFNPVYLLPLVEVVGGKNTAPEAVQAAMKVYESLGMRPL
HVRKEVPGFIADRLLEALWREALHLVNDGVATTGEIDDAIRFGAGLRWSFMGTFLTYTLA
GGDAGMRHFMAQFGPALQLPWTYLPAPELTDKLIDDVVDGTSDQLGKHSISALERYRDDC
LLAVLEAVKTTKAKHGMTFSE