Protein Info for AO353_07740 in Pseudomonas fluorescens FW300-N2E3

Updated annotation (from data): ABC transporter for Carnitine, substrate-binding component
Rationale: Specific phenotypes on Carnitine Hydrochloride. Similar to CaiX (see PMID:19919675). This transporter may also have a second SBP, AO353_07780, similar to CbcX, which is reported to be an alternate SBP for choline or glycine utilization (ibid). However _07780 is also important for carnitine utilization - it might be an additional necessary subunit of this transporter.
Original annotation: glycine/betaine ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR03414: choline ABC transporter, periplasmic binding protein" amino acids 23 to 310 (288 residues), 431.9 bits, see alignment E=5.6e-134 PF04069: OpuAC" amino acids 32 to 284 (253 residues), 194.5 bits, see alignment E=1.3e-61

Best Hits

KEGG orthology group: K02002, glycine betaine/proline transport system substrate-binding protein (inferred from 92% identity to pfo:Pfl01_5230)

Predicted SEED Role

"L-proline glycine betaine binding ABC transporter protein ProX (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WDQ6 at UniProt or InterPro

Protein Sequence (314 amino acids)

>AO353_07740 ABC transporter for Carnitine, substrate-binding component (Pseudomonas fluorescens FW300-N2E3)
MKRLISSCVLALSGTAFLSSGAMAADPAACQNVRMGVVNWTDVIATSAMTQVLLDGLGYK
TKQTSASQQIIFAGIRDQRLDMFLGYWNPLMTQTITPFVAGKQVTVLSEPSLKDARATLA
VPTYLADKGLKTFADIAKFEKELGGKIYGIEPGSGANTQIKEMIAKNQFGLGKFQLVESS
EAGMLAAVDRAVRRNEAVVFFGWAPHPMNVNVKMTYLTGSQDALGPNEGSATVWTVTAPN
YASQCPNVSRLLSNLTFTAEDESRMMQPLLDHKDAFESAKQWLKDHPQDKQRWLEGVTTF
DGKPAAENLQLSSQ