Protein Info for AO353_07510 in Pseudomonas fluorescens FW300-N2E3

Annotation: malonyl-[acyl-carrier protein] O-methyltransferase BioC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF01209: Ubie_methyltran" amino acids 19 to 151 (133 residues), 44.2 bits, see alignment E=6.4e-15 TIGR02072: malonyl-acyl carrier protein O-methyltransferase BioC" amino acids 22 to 268 (247 residues), 255.5 bits, see alignment E=3e-80 PF13489: Methyltransf_23" amino acids 36 to 190 (155 residues), 51.1 bits, see alignment E=5.2e-17 PF13847: Methyltransf_31" amino acids 53 to 168 (116 residues), 57.9 bits, see alignment E=4.2e-19 PF01728: FtsJ" amino acids 56 to 125 (70 residues), 26.4 bits, see alignment E=2.5e-09 PF08242: Methyltransf_12" amino acids 58 to 149 (92 residues), 51.7 bits, see alignment E=4.9e-17 PF13649: Methyltransf_25" amino acids 58 to 147 (90 residues), 72 bits, see alignment E=2.2e-23 PF08241: Methyltransf_11" amino acids 58 to 151 (94 residues), 85.9 bits, see alignment E=9.6e-28

Best Hits

Swiss-Prot: 71% identical to BIOC_PSEA7: Malonyl-[acyl-carrier protein] O-methyltransferase (bioC) from Pseudomonas aeruginosa (strain PA7)

KEGG orthology group: K02169, biotin synthesis protein BioC (inferred from 84% identity to pba:PSEBR_a5178)

Predicted SEED Role

"Biotin synthesis protein BioC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WDJ0 at UniProt or InterPro

Protein Sequence (270 amino acids)

>AO353_07510 malonyl-[acyl-carrier protein] O-methyltransferase BioC (Pseudomonas fluorescens FW300-N2E3)
MTDLALPSLPGGLPDKRQVAASFSRAAASYDSVAELQRAVGSELLGRLPADRSPARWLDL
GCGTGYFSRVLGERFHASEGLALDIAQGMLKHARPLGGATHFIAGDAERLPLQDASCDLV
FSSLAVQWCADFRAVLSEANRVLKPGGVLAFASLCVGTLYELRDSWRQVDGLVHVNRFRE
FSTYQQLCVASGMNVISLQSCPHVLHYPDVRSLTHELKALGAHNLNPGRPGGLTGRARIM
GLIDAYEQFRQAQGLPATYQVVYAVLEKPL