Protein Info for AO353_07345 in Pseudomonas fluorescens FW300-N2E3

Updated annotation (from data): ycgB component of nitrogen-related signalling system (of yeaGH-ycgB)
Rationale: conserved cofitness; yeaG is a protein kinase
Original annotation: SpoVR family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 PF04293: SpoVR" amino acids 16 to 447 (432 residues), 613.6 bits, see alignment E=7.9e-189

Best Hits

Swiss-Prot: 66% identical to YCGB_ECOLI: Uncharacterized protein YcgB (ycgB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 95% identity to pfl:PFL_5655)

Predicted SEED Role

"FIG004684: SpoVR-like protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WSL3 at UniProt or InterPro

Protein Sequence (520 amino acids)

>AO353_07345 ycgB component of nitrogen-related signalling system (of yeaGH-ycgB) (Pseudomonas fluorescens FW300-N2E3)
MTAKEQKRQPISTGSEWTFELIQAYDREISRLAARYALDTYPNQIEVITAEQMMDAYASV
GMPLGYHHWSYGKHFLSTEKSYSRGQMGLAYEIVINSDPCIAYLMEENTICMQALVVAHA
CYGHNSFFKGNYLFRTWTDASSIIDYLVFAKQYIMQCEERHGIDAVEDLLDSCHALMNYG
VDRYKRPYPISAEEERRRQKDREEHLQKQINDLWRTIPKGADKFNEKDNARFPAEPQENI
LYFIEKHAPLLEPWQREIVRIVRKIAQYFYPQRQTQVMNEGWATFWHYTLMNDLYDEGLV
TDGFMMEFLASHTSVIFQPGFDSPYYNGINPYTLGFSMYRDIRRMCEAPTEEDYRWFPEI
AGTDWLSSIKFAMSSFKDESFILQYLSPKVIRDLKLFSILDDDQKDDLLVPAIHDEEGYR
TIRETLAAQYNLGNREPNIQIYSIDRRGDRSLTLRHQQHDRKPLGDSTEEVLKHLHRLWG
FDIHLETLQGDQVMKTHHVPPKGEHSEGEYGRMDLAVIHL