Protein Info for AO353_07340 in Pseudomonas fluorescens FW300-N2E3

Updated annotation (from data): yeaH component of nitrogen-related signalling system (of yeaGH-ycgB)
Rationale: PFam PF04285.8 (DUF444). conserved cofitness; yeaG is a protein kinase
Original annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 PF04285: DUF444" amino acids 4 to 419 (416 residues), 609 bits, see alignment E=2.5e-187

Best Hits

Swiss-Prot: 97% identical to Y5140_PSEPF: UPF0229 protein Pfl01_5140 (Pfl01_5140) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K09786, hypothetical protein (inferred from 97% identity to pfo:Pfl01_5140)

Predicted SEED Role

"FIG002076: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WFE3 at UniProt or InterPro

Protein Sequence (423 amino acids)

>AO353_07340 yeaH component of nitrogen-related signalling system (of yeaGH-ycgB) (Pseudomonas fluorescens FW300-N2E3)
MSYVIDRRLNGKNKSTVNRQRFLRRYRDHIKKAVEEAVSRRSITDMEHGEQISIPGRDID
EPVLHHGRGGKQTIVHPGNKEFTSGEHIARPPGGGGGRGPGKAGNSGEGMDEFVFQITQE
EFLEFMFEDLELPNLVKRNLSGTDTFKTVRAGISNEGNPSRINIIRTLRSAHARRIALSG
SSREKLRVAKEELARLKQEEPDNFGDIQEIEAEIERLSARINRVPFLDTFDLKYNLLIKQ
PNPSSKAVMFCLMDVSGSMTQATKDIAKRFFILLYLFLKRNYEKIDVVFIRHHTSAREVD
EEEFFYSRETGGTIVSSALKLMQEIMAERYPSNDWNIYAAQASDGDNWNDDSPICRDILI
NQIMPFVQYYTYVEITPREHQALWYEYERISEAFSDTFAQQQLVSAGDIYPVFRELFQRR
LVT