Protein Info for AO353_07275 in Pseudomonas fluorescens FW300-N2E3

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 796 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 276 to 297 (22 residues), see Phobius details PF00497: SBP_bac_3" amino acids 46 to 264 (219 residues), 88.3 bits, see alignment E=2.5e-28 TIGR00229: PAS domain S-box protein" amino acids 323 to 446 (124 residues), 48.8 bits, see alignment E=3.8e-17 amino acids 476 to 579 (104 residues), 31.2 bits, see alignment E=1e-11 PF00989: PAS" amino acids 333 to 437 (105 residues), 31.1 bits, see alignment E=9.5e-11 PF08448: PAS_4" amino acids 334 to 442 (109 residues), 32.9 bits, see alignment E=3e-11 PF13426: PAS_9" amino acids 339 to 439 (101 residues), 36.2 bits, see alignment E=2.7e-12 PF08447: PAS_3" amino acids 480 to 561 (82 residues), 47.3 bits, see alignment E=9.3e-16 PF07730: HisKA_3" amino acids 600 to 666 (67 residues), 52.2 bits, see alignment E=3.3e-17 PF02518: HATPase_c" amino acids 706 to 795 (90 residues), 49.6 bits, see alignment E=2.3e-16

Best Hits

KEGG orthology group: None (inferred from 87% identity to pfl:PFL_5641)

Predicted SEED Role

"Probable two-component sensor, near polyamine transporter" in subsystem Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WFD0 at UniProt or InterPro

Protein Sequence (796 amino acids)

>AO353_07275 histidine kinase (Pseudomonas fluorescens FW300-N2E3)
MMRFRCLLVIGCCWLPLMAWAAPALPAHGAPLSVEQHQWLAEHSELRVGVVLQAPFAQYD
RRLQRLSGANIELMQWLARSLNIEFSWRHFPDVAQLEEAVREGEVDLAPGMTQTPAGLRL
WQFSDPYMRVPQLVVGEQKGAGAIELEKIDSLSRVAVRMPGAIADYLRNTYGNLNLQGVP
TEREALQLLLAQQARYAVVDEAQLSRLSIEPEFSGLVVVGDIGLPQLLRVATRRDWPELA
GIVESALHAIPAKDLEQLHASWLQPKYPRLTESPGFWQNLCLLLAVLFLSSMAIVLWQRR
QQHTLEQRLLAAREDIALREASEEALRLTQFSIDQSTVGILWVNWDSHVRYANRAAEAML
GYAPGGVIDRPLIDFEPGLHMDRWLRLWKSARASEDAPQSFETNCVRADGSILPADVSLS
FLRFRDSEYLVVYLNDVTERRRALAALQESEARLQGIAANVPGLVFRLERAPVTGQIDFA
YISEGSESLVGYSPATLSRRDMGLRSLVHPDDKASYHQTQDYALDTDSDWSWQGRILTRQ
GEERWAEIKAITRRLDDGAFVWDGIVWDISESKRIELELASSREQLRELSAHLESVREEE
KARIAREVHDELGQMLTVLKLETSMCELAYAELDPGLSERLNSMKRLIAQLFQLVRDVAT
ALRPPILDAGIASAIEWQARRFEARTQIPCLVQVPDNLPTLSDAKAIGLFRILQEALTNV
MRHAQAHTVELTLVQEGDELCLTVSDDGVGFVAPEGRPTSFGVVGMRERVLIMGGQLSLE
SEPGEGTTLCVCVPLD