Protein Info for AO353_07220 in Pseudomonas fluorescens FW300-N2E3

Annotation: anthranilate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00566: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase
  • amino acids 1 to 191 (191 residues), 288.1 bits, E=1.6e-90
• PF00117: GATase
  • amino acids 3 to 191 (189 residues), 217.4 bits, E=1.5e-68
• PF07722: Peptidase_C26
  • amino acids 70 to 175 (106 residues), 34.1 bits, E=2.4e-12

Best Hits

Swiss-Prot: 90% identical to TRPG_PSEPU: Anthranilate synthase component 2 (trpG) from Pseudomonas putida

KEGG orthology group: K01658, anthranilate synthase component II [EC: 4.1.3.27] (inferred from 98% identity to pba:PSEBR_a5119)

MetaCyc: 81% identical to anthranilate synthase beta subunit (Pseudomonas aeruginosa PAO1)
Anthranilate synthase. [EC: 4.1.3.27]

Predicted SEED Role

"Anthranilate synthase, amidotransferase component (EC 4.1.3.27) @ Para-aminobenzoate synthase, amidotransferase component (EC 2.6.1.85)" (EC 2.6.1.85, EC 4.1.3.27)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• L-tryptophan biosynthesis (6/6 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• L-glutamate and L-glutamine biosynthesis (6/7 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• superpathway of chorismate metabolism (43/59 steps found)
• 4-aminobenzoate biosynthesis I (2/2 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• 4-hydroxy-2(1H)-quinolone biosynthesis (2/5 steps found)
• acridone alkaloid biosynthesis (1/4 steps found)
• superpathway of candicidin biosynthesis (4/11 steps found)
• superpathway of quinolone and alkylquinolone biosynthesis (2/10 steps found)
• chloramphenicol biosynthesis (1/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Folate biosynthesis
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85, 4.1.3.27

Use Curated BLAST to search for 2.6.1.85 or 4.1.3.27

Sequence Analysis Tools

See A0A0N9WSJ2 at UniProt or InterPro

Protein Sequence (197 amino acids)

>AO353_07220 anthranilate synthase (Pseudomonas fluorescens FW300-N2E3)
MLLMIDNYDSFTYNVVQYLGELGSEVKVVRNDELTIAEIEALKPERIVVSPGPCTPTEAG
VSIEAIKYFAGKLPILGVCLGHQSIGQAFGGDVVRARQVMHGKTSPVFHEDKGVFEGLNR
PLTVTRYHSLIVKRETLPDCLELTAWTQLEDGSVDEIMGLRHKTLNIEGVQFHPESILTE
QGHELFANFLKQTGGTR