Protein Info for AO353_07200 in Pseudomonas fluorescens FW300-N2E3
Annotation: cyclic AMP receptor protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 85% identical to VFR_PSEAE: Cyclic AMP receptor-like protein (vfr) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: K10914, CRP/FNR family transcriptional regulator, cyclic AMP receptor protein (inferred from 95% identity to pba:PSEBR_a5115)Predicted SEED Role
"Vfr transcriptional regulator / Cyclic AMP receptor protein" in subsystem CytR regulation or cAMP signaling in bacteria or Quorum sensing regulation in Pseudomonas
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0N9VRQ9 at UniProt or InterPro
Protein Sequence (214 amino acids)
>AO353_07200 cyclic AMP receptor protein (Pseudomonas fluorescens FW300-N2E3) MVAITPTPKIKNLDKLLMHCQRRRYQAKSNIICAGDRSDTLFFIIKGSVTILIEDDDGRE MIIAYLNAGDFFGELGLFEQAGQEQERSAWVRAKVECEVAEISYCKFRELSQQDPDILYV LSGQIAQRLRNTTRKVGDLAFFDVTGRVARCLLELCKQPDAMTHPDGMQIKVTRQEIGRI VGCSREMVGRVLKDLEERNLVNVKGKTMVVFGTR