Protein Info for AO353_07190 in Pseudomonas fluorescens FW300-N2E3

Annotation: S-adenosylmethionine decarboxylase proenzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03331: S-adenosylmethionine decarboxylase proenzyme
  • amino acids 4 to 262 (259 residues), 479 bits, E=1.7e-148
• PF02675: AdoMet_dc
  • amino acids 45 to 170 (126 residues), 54.2 bits, E=8.5e-19

Best Hits

Swiss-Prot: 96% identical to SPED_PSEPF: S-adenosylmethionine decarboxylase proenzyme (speD) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K01611, S-adenosylmethionine decarboxylase [EC: 4.1.1.50] (inferred from 96% identity to pfo:Pfl01_5109)

MetaCyc: 68% identical to S-adenosylmethionine decarboxylase proenzyme (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"S-adenosylmethionine decarboxylase proenzyme (EC 4.1.1.50), prokaryotic class 1A" in subsystem Polyamine Metabolism (EC 4.1.1.50)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (16/17 steps found)
• L-methionine salvage cycle III (10/11 steps found)
• superpathway of polyamine biosynthesis I (7/8 steps found)
• aminopropylcadaverine biosynthesis (3/3 steps found)
• spermidine biosynthesis I (2/2 steps found)
• L-methionine salvage cycle I (bacteria and plants) (9/12 steps found)
• superpathway of polyamine biosynthesis II (6/8 steps found)
• spermine biosynthesis (1/2 steps found)
• spermidine biosynthesis III (2/4 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Methionine metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.50

Sequence Analysis Tools

See A0A0N7GZN6 at UniProt or InterPro

Protein Sequence (264 amino acids)

>AO353_07190 S-adenosylmethionine decarboxylase proenzyme (Pseudomonas fluorescens FW300-N2E3)
VKSKLKLHGFNNLTKTLSFNIYDICYAETPQDQQAYVEYINKEYNAKRLTQILTEVVDII
GANILNIASQDYEPQGASVTILISEEPVTPTDSQIEESPGPLPEIILAHLDKSHITVHTY
PEIHPVDGIATFRVDIDVSTCGVISPLKALNFLIHQFDSDIVTVDYRVRGFTRDIEGKKH
FIDHEINSIQNYLSEDTRDAYQMTDVNVYQENLFHTKMLLKNFELDNYLFGDATSNLSSE
QRAQVTERVKHEMLEIFYARNMSS