Protein Info for AO353_07180 in Pseudomonas fluorescens FW300-N2E3

Annotation: zinc-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF11969: DcpS_C
  • amino acids 3 to 105 (103 residues), 81.7 bits, E=5.5e-27
• PF01230: HIT
  • amino acids 10 to 106 (97 residues), 102.3 bits, E=1.9e-33

Best Hits

Swiss-Prot: 59% identical to HINT1_BOVIN: Histidine triad nucleotide-binding protein 1 (HINT1) from Bos taurus

KEGG orthology group: K02503, Hit-like protein involved in cell-cycle regulation (inferred from 97% identity to pfo:Pfl01_5107)

MetaCyc: 48% identical to purine nucleoside phosphoramidase (Escherichia coli K-12 substr. MG1655)
3.9.1.-

Predicted SEED Role

"Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) (EC 3.6.1.17)" (EC 3.6.1.17)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.17

Sequence Analysis Tools

See A0A0N9W9Q5 at UniProt or InterPro

Protein Sequence (112 amino acids)

>AO353_07180 zinc-binding protein (Pseudomonas fluorescens FW300-N2E3)
VDTLFTKIINREIPAKIIYEDDQVLAFHDIAPQAPVHFLVVPKKPVRTLNDLTEDDKALA
GHILFTAQRLALELGCEEGFRVVMNCNELGGQTVYHIHMHVLGQRQMHWPPG