Protein Info for AO353_07155 in Pseudomonas fluorescens FW300-N2E3

Annotation: N-acetyl-gamma-glutamyl-phosphate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01850: N-acetyl-gamma-glutamyl-phosphate reductase
  • amino acids 2 to 344 (343 residues), 439.9 bits, E=3.5e-136
• PF01118: Semialdhyde_dh
  • amino acids 3 to 142 (140 residues), 130.1 bits, E=9.1e-42
• PF03807: F420_oxidored
  • amino acids 3 to 100 (98 residues), 23.3 bits, E=1.2e-08
• PF02774: Semialdhyde_dhC
  • amino acids 161 to 315 (155 residues), 73.2 bits, E=4.8e-24

Best Hits

Swiss-Prot: 98% identical to ARGC_PSEPF: N-acetyl-gamma-glutamyl-phosphate reductase (argC) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K00145, N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase [EC: 1.2.1.- 1.2.1.38] (inferred from 97% identity to pfl:PFL_5611)

Predicted SEED Role

"N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)" in subsystem Arginine Biosynthesis extended (EC 1.2.1.38)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (16/17 steps found)
• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• L-ornithine biosynthesis I (5/5 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Geraniol degradation
• Limonene and pinene degradation
• Lysine biosynthesis
• Naphthalene and anthracene degradation
• Tryptophan metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.-

Use Curated BLAST to search for 1.2.1.- or 1.2.1.38

Sequence Analysis Tools

See A0A0N9WF92 at UniProt or InterPro

Protein Sequence (344 amino acids)

>AO353_07155 N-acetyl-gamma-glutamyl-phosphate reductase (Pseudomonas fluorescens FW300-N2E3)
MVKVGIVGGTGYTGVELLRLLAQHPQAEVVVITSRSEAGLAVADMYPNLRGHYDGLAFSV
PDIKTLGACDVVFFATPHGVAHALAGELLAAGTKVIDLSADFRLQDADEWAKWYGQPHGA
PELLEEAVYGLPEVNREQIRQARLIAVPGCYPTATQLGFLPLLEAGLADTSRLIADCKSG
VSGAGRGASVGSLYSETSESMKAYAVKGHRHLPEIRQGLRRAAGKDVGLTFVPHLTPMIR
GIHSTLYATVVDRSIDLQALFEKRYANEPFVDVMPAGSHPETRSVRGANVCRIAVHRPQD
GDLVVVLSVIDNLVKGASGQAVQNLNILFGLDERLGLSHAGMLP