Protein Info for AO353_07105 in Pseudomonas fluorescens FW300-N2E3

Annotation: biotin--protein ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 PF08279: HTH_11" amino acids 2 to 54 (53 residues), 41.8 bits, see alignment 8.2e-15 TIGR00121: biotin--[acetyl-CoA-carboxylase] ligase" amino acids 78 to 313 (236 residues), 192.2 bits, see alignment E=5.4e-61 PF03099: BPL_LplA_LipB" amino acids 81 to 206 (126 residues), 79.9 bits, see alignment E=1.7e-26

Best Hits

KEGG orthology group: K03524, BirA family transcriptional regulator, biotin operon repressor / biotin-[acetyl-CoA-carboxylase] ligase [EC: 6.3.4.15] (inferred from 82% identity to pba:PSEBR_a5102)

Predicted SEED Role

"Biotin operon repressor / Biotin-protein ligase (EC 6.3.4.15)" in subsystem Biotin biosynthesis (EC 6.3.4.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W3A9 at UniProt or InterPro

Protein Sequence (319 amino acids)

>AO353_07105 biotin--protein ligase (Pseudomonas fluorescens FW300-N2E3)
MLTLLKLLKDGRFHSGQALGAALGISRSAVWKQLQHLEAELGLSIHKVRGRGYQLSAPLT
LLSSAKIAEHSPACDWPVLVFDSIDSTNAEALRSIERGMAAPFLVLAERQTAGRGRRGRK
WVSPFAENIYYSLVLRIDGGMRQLEGLSLVVGLAVMQTLRDLGIAGAGLKWPNDVLVGEK
KIAGILLELVGDPADVCHVVLGVGINVNMQIADEVDQQWTSMRLEAGRAFDRNLLVAHLG
IVLQGYLSRHQSAGFSALRAEWEQSHLWQGRAVSLIAGVSRIDGEVIGIDGQGALRLNVG
GVEKVFSGGELSLRLRNDS