Protein Info for AO353_07015 in Pseudomonas fluorescens FW300-N2E3

Annotation: elongation factor G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 701 TIGR00484: translation elongation factor G" amino acids 1 to 700 (700 residues), 1165.7 bits, see alignment E=0 TIGR00231: small GTP-binding protein domain" amino acids 9 to 187 (179 residues), 111.4 bits, see alignment E=3.8e-36 PF00009: GTP_EFTU" amino acids 9 to 288 (280 residues), 206 bits, see alignment E=9.8e-65 PF03144: GTP_EFTU_D2" amino acids 332 to 399 (68 residues), 67.7 bits, see alignment E=2.4e-22 PF14492: EFG_III" amino acids 412 to 486 (75 residues), 118.7 bits, see alignment E=2.4e-38 PF03764: EFG_IV" amino acids 487 to 606 (120 residues), 147.8 bits, see alignment E=3.3e-47 PF00679: EFG_C" amino acids 609 to 695 (87 residues), 102.4 bits, see alignment E=2.8e-33

Best Hits

Swiss-Prot: 98% identical to EFG_PSE14: Elongation factor G (fusA) from Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)

KEGG orthology group: K02355, elongation factor G (inferred from 98% identity to psp:PSPPH_4595)

Predicted SEED Role

"Translation elongation factor G" in subsystem Translation elongation factor G family or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VLV6 at UniProt or InterPro

Protein Sequence (701 amino acids)

>AO353_07015 elongation factor G (Pseudomonas fluorescens FW300-N2E3)
MARTTPISRYRNIGIVAHVDAGKTTTTERVLFYTGKSHKMGEVHDGAATTDWMVQEQERG
ITITSAAITAFWQGSAKQHKDQYRFNVIDTPGHVDFTIEVERSLRVLDGAVVVFCGTSGV
EPQSETVWRQANKYGVPRIVYVNKMDRAGANFLRVIAQIKQRLGHTPVPIQLAIGSEDNF
QGQIDLMTMEAVYWNDADKGMTPRREAIPAELQELAEEWRSNMVEAAAEASEELMNKYLE
GEELSIEEIKAALRQRTIAGEIVLAVCGSSFKNKGVPLVLDAVIDYLPAPTDIPAIKGTD
PDDEEKQMERHASDDEPFSALAFKIATDPFVGTLTFVRVYSGVLASGDGVINSVKGKKER
VGRMVQMHANAREEIKEVRAGDIAALIGMKDVTTGETLCNADKPIILVRMDFPEPVISVA
VEPKTKDDQEKMGIALGKLAQEDPSFRVKTDEETGQTIISGMGELHLDILVDRMRREFNV
EANIGKPQVSYRERITKSCEIEGKFVRQSGGRGQFGHCWIRFAPADEGQEGLQFLNEVVG
GVVPKEYIPAIQKGIEEQMKNGVVAGYPLIGLKATVFDGSYHDVDSNEMAFKVAASMATK
QLAQKGGGELLEPIMAVEVVTPEDYMGDVMGDLNRRRGMILGMEDTVSGKVIRAEVPLGE
MFGYATDVRSMSQGRASYSMEFKKYNTAPSHIVETVTKKQG