Protein Info for AO353_06905 in Pseudomonas fluorescens FW300-N2E3

Annotation: 50S ribosomal protein L15

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 TIGR01071: ribosomal protein uL15" amino acids 2 to 143 (142 residues), 144.4 bits, see alignment E=1.1e-46 PF00828: Ribosomal_L27A" amino acids 28 to 143 (116 residues), 95.7 bits, see alignment E=1.8e-31

Best Hits

Swiss-Prot: 99% identical to RL15_PSEPF: 50S ribosomal protein L15 (rplO) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K02876, large subunit ribosomal protein L15 (inferred from 98% identity to pba:PSEBR_a5077)

MetaCyc: 66% identical to 50S ribosomal subunit protein L15 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L15p (L27Ae)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C1ZN13 at UniProt or InterPro

Protein Sequence (145 amino acids)

>AO353_06905 50S ribosomal protein L15 (Pseudomonas fluorescens FW300-N2E3)
MKLNDLSPAPGSRREKHRPGRGIGSGLGKTGGRGHKGQTSRSGGTIAPGFEGGQQPLHRR
LPKFGFVSLKAMDRAEVRLSELAKVEGDIVTVQSLKDANVINVNVQRVKIMLSGEVTRAV
TIGKGIGATKGARAAIEAAGGKFEE