Protein Info for AO353_06795 in Pseudomonas fluorescens FW300-N2E3

Annotation: Isochorismatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 PF00857: Isochorismatase" amino acids 5 to 147 (143 residues), 130.5 bits, see alignment E=3.7e-42

Best Hits

Swiss-Prot: 47% identical to YDDQ_BACSU: Uncharacterized isochorismatase family protein YddQ (yddQ) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 85% identity to pba:PSEBR_a5062)

Predicted SEED Role

"Isochorismatase (EC 3.3.2.1)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. (EC 3.3.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.3.2.1

Use Curated BLAST to search for 3.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W9I2 at UniProt or InterPro

Protein Sequence (184 amino acids)

>AO353_06795 Isochorismatase (Pseudomonas fluorescens FW300-N2E3)
MAKQALIVVDIQNDYFPQGKWPLVGADAAADNAARVIQAFRDAGDQVVHIRHEFTSDTAP
FFTPGSEGAQLHQKVRNRSHEPVVLKHFVNAFRETELEAILDQHGIDNLVIVGSMSHMCI
DGAARAAADLGYGVTVIHDACATRDLEFNGVIVPAAQVHAAFMSALGFAYATVVSTDDFL
AASH