Protein Info for AO353_06490 in Pseudomonas fluorescens FW300-N2E3

Annotation: nicotinate-nucleotide adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00125: cytidyltransferase-like domain
  • amino acids 20 to 81 (62 residues), 31.8 bits, E=1.2e-11
• TIGR00482: nicotinate (nicotinamide) nucleotide adenylyltransferase
  • amino acids 22 to 225 (204 residues), 161.7 bits, E=2.2e-51
• PF01467: CTP_transf_like
  • amino acids 22 to 199 (178 residues), 81.6 bits, E=3.1e-27

Best Hits

Swiss-Prot: 92% identical to NADD_PSEF5: Probable nicotinate-nucleotide adenylyltransferase (nadD) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K00969, nicotinate-nucleotide adenylyltransferase [EC: 2.7.7.18] (inferred from 90% identity to pba:PSEBR_a4967)

Predicted SEED Role

"Nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.7.7.18)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• NAD de novo biosynthesis I (5/6 steps found)
• NAD de novo biosynthesis III (5/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
• NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (3/4 steps found)
• NAD salvage pathway I (PNC VI cycle) (5/7 steps found)
• NAD de novo biosynthesis II (from tryptophan) (6/9 steps found)
• NAD salvage pathway II (PNC IV cycle) (3/5 steps found)
• NAD salvage pathway V (PNC V cycle) (3/5 steps found)
• superpathway of NAD biosynthesis in eukaryotes (9/14 steps found)
• NAD salvage (plants) (6/11 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.18

Use Curated BLAST to search for 2.7.7.18

Sequence Analysis Tools

See A0A0N7GZM0 at UniProt or InterPro

Protein Sequence (229 amino acids)

>AO353_06490 nicotinate-nucleotide adenylyltransferase (Pseudomonas fluorescens FW300-N2E3)
LGDLGQSAAVTASETGPRRIGVLGGTFDPVHIGHLRSALEVAESLALDELRLTPSARPPH
RDTPQVSAQDRLAMVERAVAGIAPLVVDDRELKRDKPSYTIDTLELMRAELAADDQLFLL
LGWDAFCGLPTWHRWEELLQHCHILVLQRPDADSEPPDALRNLLAARSVSDPLALKGSSG
QIAFVWQTPLAVSATQIRQLLASGKSVRFLVPDAVLAYIDAHGLYRASN