Protein Info for AO353_06195 in Pseudomonas fluorescens FW300-N2E3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 40 to 57 (18 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 108 to 134 (27 residues), see Phobius details amino acids 191 to 214 (24 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details amino acids 295 to 318 (24 residues), see Phobius details amino acids 330 to 347 (18 residues), see Phobius details amino acids 353 to 377 (25 residues), see Phobius details amino acids 389 to 412 (24 residues), see Phobius details amino acids 419 to 439 (21 residues), see Phobius details PF07690: MFS_1" amino acids 46 to 403 (358 residues), 183.1 bits, see alignment E=3.6e-58

Best Hits

KEGG orthology group: K08191, MFS transporter, ACS family, hexuronate transporter (inferred from 94% identity to pba:PSEBR_a4911)

Predicted SEED Role

"Hexuronate transporter" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W958 at UniProt or InterPro

Protein Sequence (450 amino acids)

>AO353_06195 hypothetical protein (Pseudomonas fluorescens FW300-N2E3)
MIPSQSSHTESARMASGLGVATGGIGDKIRGAMAVGKTRWGMLALVFFATTLNYIDRAAL
GVMQPILAKEMSWTAMDYANINFWFQVGYAVGFVLQGRLIDRIGVKRVFFCAVLLWSLAT
GAHGLATSALGFMVCRFILGLTEAANYPACVKTTRLWFPAGERAVATGIFNAGTNVGAMF
TPMLLPLILHVWGWQAAFLCMSALGGIWLVFWGLKYFNPEDHPSVKQSELDYIQNEAEPE
QARVPFSRILRMRGTWAFALAYSMTAPVFWFYLYWLPPFLNQQYNLGINVTQMGIPLIII
YMTADFGSVGGGILSSFLIGRGVNPIKARLMSMLLFACCIIGVIMAAGSSNLWVAVFAIS
LAIGAHQAWTANIWSLVMDYTPKHMMSTVFGFGGMCAAIGGMFMTQLVGHILTITNNNYT
VLFTMIPAMYFIALIWLYFMAPRKIPNLED