Protein Info for AO353_05960 in Pseudomonas fluorescens FW300-N2E3

Annotation: anthranilate dioxygenase reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 PF00111: Fer2" amino acids 10 to 85 (76 residues), 65.2 bits, see alignment E=6.3e-22 PF00970: FAD_binding_6" amino acids 110 to 204 (95 residues), 72.5 bits, see alignment E=4.6e-24 PF00175: NAD_binding_1" amino acids 214 to 317 (104 residues), 74.1 bits, see alignment E=2.1e-24

Best Hits

Swiss-Prot: 62% identical to ANTDC_ACIAD: Anthranilate 1,2-dioxygenase electron transfer component (antC) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K11311, anthranilate dioxygenase reductase (inferred from 78% identity to pfl:PFL_0757)

MetaCyc: 62% identical to anthranilate dioxygenase reductase component (Acinetobacter baylyi ADP1)
Anthranilate 1,2-dioxygenase (deaminating, decarboxylating). [EC: 1.14.12.1]

Predicted SEED Role

"benzoate dioxygenase, ferredoxin reductase component; Anthranilate dioxygenase reductase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.1

Use Curated BLAST to search for 1.14.12.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VQY9 at UniProt or InterPro

Protein Sequence (340 amino acids)

>AO353_05960 anthranilate dioxygenase reductase (Pseudomonas fluorescens FW300-N2E3)
MNHKVAFSFADGKTLFFPVQANEILLDAALRNGINIPLDCREGVCGTCQGRCESGDYSQD
YVDEEALSSLDLQQRKMLTCQTRVKSDAAFYFDFASSLCNAAGPEQLSGTVTHVRQVSTS
TAILHLDLGAATQPLDFLPGQYARLLIPGTMSKRSYSFANRPSSSNQLQFLIRLLPDGVM
SNYIRERCQVGDEIALEAPLGAFYLRHIARPLILVAGGTGLSALLGMLDEIVARGCEQPV
HLYYGVRDAADLCEGERFSAYAHRIPGFRYTPVVSDPSPGWEGKRGYIAEHFDACELRDA
AVDMYVCGPPPMVESIKRWLQDQTLENVQLYYEKFTDSNV