Protein Info for AO353_05955 in Pseudomonas fluorescens FW300-N2E3

Updated annotation (from data): Anthranilate 1,2-dioxygenase (deaminating, decarboxylating) (EC 1.14.12.1)
Rationale: Specifically important for utilizing L-Tryptophan. Automated validation from mutant phenotype: the predicted function (1.14.12.1-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: benzoate 1,2-dioxygenase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13577: SnoaL_4
  • amino acids 7 to 144 (138 residues), 27 bits, E=4e-10
• TIGR03231: anthranilate 1,2-dioxygenase, small subunit
  • amino acids 9 to 163 (155 residues), 293.6 bits, E=1.9e-92
• PF00866: Ring_hydroxyl_B
  • amino acids 16 to 156 (141 residues), 163 bits, E=4.8e-52

Best Hits

Swiss-Prot: 56% identical to ANTDB_ACIAD: Anthranilate 1,2-dioxygenase small subunit (antB) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K05600, anthranilate 1,2-dioxygenase (deaminating, decarboxylating) small subunit [EC: 1.14.12.1] (inferred from 90% identity to pfs:PFLU5195)

MetaCyc: 56% identical to anthranilate dioxygenase oxygenase component small subunit (Acinetobacter)
Anthranilate 1,2-dioxygenase (deaminating, decarboxylating). [EC: 1.14.12.1]

Predicted SEED Role

"Benzoate 1,2-dioxygenase beta subunit (EC 1.14.12.10)" in subsystem Benzoate degradation (EC 1.14.12.10)

MetaCyc Pathways

• benzoate degradation I (aerobic) (2/2 steps found)
• anthranilate degradation I (aerobic) (1/1 steps found)
• 2-nitrobenzoate degradation II (1/3 steps found)
• meta cleavage pathway of aromatic compounds (4/10 steps found)
• mandelate degradation to acetyl-CoA (9/18 steps found)
• toluene degradation IV (aerobic) (via catechol) (4/13 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (18/35 steps found)
• superpathway of aerobic toluene degradation (11/30 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (11/42 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Carbazole degradation
• Fluorobenzoate degradation
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.1, 1.14.12.10

Use Curated BLAST to search for 1.14.12.1 or 1.14.12.10

Sequence Analysis Tools

See A0A0N9WCQ1 at UniProt or InterPro

Protein Sequence (163 amino acids)

>AO353_05955 Anthranilate 1,2-dioxygenase (deaminating, decarboxylating) (EC 1.14.12.1) (Pseudomonas fluorescens FW300-N2E3)
MNPQLQYQIEQFFYRKSELCDAKDWDAYIQLFDEQSEFHLPQWDSEHVYTRDPKREMSLI
YYANRSGLEDRVFRLHTGKAASATPMPRTLHLINNVRISELEAGELEVRLNWHTLFYRLA
TSEQFYGDATYRLKPHADSWLITRKHVLLLNDTINSVLDFYHL