Protein Info for AO353_05945 in Pseudomonas fluorescens FW300-N2E3

Annotation: AraC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF14525: AraC_binding_2" amino acids 22 to 203 (182 residues), 120.3 bits, see alignment E=1.2e-38 PF12833: HTH_18" amino acids 249 to 328 (80 residues), 62.9 bits, see alignment E=4.2e-21

Best Hits

KEGG orthology group: None (inferred from 86% identity to pfs:PFLU5193)

Predicted SEED Role

"benABC operon transcriptional activator BenR" in subsystem Benzoate degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W912 at UniProt or InterPro

Protein Sequence (337 amino acids)

>AO353_05945 AraC family transcriptional regulator (Pseudomonas fluorescens FW300-N2E3)
MSSKADPQFRDIRIDHYDLEGARTWMSGICGPHRLETATPERIRFHHTANVFKSMATTLG
TIEYGTDVTVDIEDAEHFSSYSLSLPLVGEQELSKNGTLLKSNRDQGVIISPNENQMLAI
SGDCRKVQVVITRAAMSESLEEMLQRPLDAPLRFESVMDAVDGASASWWRMARYFIGELE
RSSALFEQVVFTRDIESSLIKGLILAQPNNYSDELRDVLGVKLPHYLIRAKQYIHDNARE
AVHLEDIEAAAGVSRFKLFEAFRKYFALSPMAYLKKYRLNAVRQDILEQGLARNISEIAM
GWGFTHMGRFSAEYRKLFDEAPSATLQRNEARRMRGL