Protein Info for AO353_05930 in Pseudomonas fluorescens FW300-N2E3

Updated annotation (from data): L-tryptophan transporter
Rationale: Specifically important for utilization of tryptophan as a nitrogen source.
Original annotation: amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 207 to 229 (23 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details amino acids 288 to 311 (24 residues), see Phobius details amino acids 337 to 359 (23 residues), see Phobius details amino acids 365 to 387 (23 residues), see Phobius details amino acids 407 to 428 (22 residues), see Phobius details amino acids 434 to 454 (21 residues), see Phobius details PF00324: AA_permease" amino acids 26 to 453 (428 residues), 335.9 bits, see alignment E=3.8e-104 PF13520: AA_permease_2" amino acids 27 to 449 (423 residues), 124.6 bits, see alignment E=5.4e-40

Best Hits

Swiss-Prot: 38% identical to YTNA_BACSU: Uncharacterized amino acid permease YtnA (ytnA) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 90% identity to pfl:PFL_0763)

MetaCyc: 39% identical to phenylalanine:H+ symporter PheP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-56

Predicted SEED Role

"Phenylalanine-specific permease" in subsystem Aromatic amino acid degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WG97 at UniProt or InterPro

Protein Sequence (470 amino acids)

>AO353_05930 L-tryptophan transporter (Pseudomonas fluorescens FW300-N2E3)
MTDTLGFETISNREHGLRRQLTSGQMSMIAIGGAIGTGLFMGSAYAIGYAGPSVLLSYAI
GAVITLLLMGCLAEMTVAHSTSGSFGAYAEFYISPLAGFLVRYAYWAAIVLAVGTEVTAV
AMYMKYWFANVPEWIWIVSFSSILIVLNAISVKTFGTFEYWFSTIKIGAIVGFIILAVYV
VFGSGNPEYGVHHYTSHGGFFPNGLQGMWVAVIVSIFSYLSVEMIAVAAGEAEDPERAVK
KAFRATIVRLVVFYLLTLALMLAIVPWVQAGHAQSPFVTVMQTIGIPGATGVMNFVILIA
ALSAMNSQLYITTRMMFSLSRGGYAPKAMGALSKSGIPLNALLLSSSGIALATLLNVMYP
ESSFTLMMAISMFGAIFTWFMIFLTHYCFRRYHQRHGERKLSFRMRLFPYTTLLGLVLMG
AVMITTYFTEAFKMTLVFGVPFLLILSLVYGVFFRKTRALAGTLDNAPAP