Protein Info for AO353_05840 in Pseudomonas fluorescens FW300-N2E3

Annotation: dolichyl-phosphate-mannose-protein mannosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 79 to 98 (20 residues), see Phobius details amino acids 108 to 125 (18 residues), see Phobius details amino acids 131 to 149 (19 residues), see Phobius details amino acids 159 to 177 (19 residues), see Phobius details amino acids 183 to 200 (18 residues), see Phobius details amino acids 212 to 231 (20 residues), see Phobius details amino acids 264 to 286 (23 residues), see Phobius details amino acids 298 to 316 (19 residues), see Phobius details amino acids 322 to 343 (22 residues), see Phobius details amino acids 365 to 386 (22 residues), see Phobius details PF02366: PMT" amino acids 42 to 228 (187 residues), 66.9 bits, see alignment E=2.1e-22 PF13231: PMT_2" amino acids 59 to 226 (168 residues), 53.8 bits, see alignment E=2.9e-18

Best Hits

KEGG orthology group: None (inferred from 75% identity to pfl:PFL_0786)

Predicted SEED Role

"Polymyxin resistance protein ArnT, undecaprenyl phosphate-alpha-L-Ara4N transferase; Melittin resistance protein PqaB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WF71 at UniProt or InterPro

Protein Sequence (484 amino acids)

>AO353_05840 dolichyl-phosphate-mannose-protein mannosyltransferase (Pseudomonas fluorescens FW300-N2E3)
MSRPAPLLLLLTCLLFFFALGNHQLQGSTEPRVAGIAMEMHLDNDWVTPRLFGQPFLEKP
PLSLWLDAGAIRAFGGTPLAVRLASAFAGLFSVMLLYTMLRRFGRPTTIAWVAGIMLATM
ASYWGNVRGVGEDALLSLGVTLALLSFYQAHRQHAEQRAALGSWLLFAVGIAIATLSKGV
LGLAMPGVVIFAYLLAESLIDKRFSLPRWMGPALATLLGLIPLVIWLFMLYQRGGSQALA
EVLLTNSVGRFNGSFVEAGHYEPFYYYLAKLPEAFLPWNILVYLGLWHFRKSLVNNRYLL
FFTLWLLAQFFMLTLASSKRTVYLMSLTPAAAVLAAEYATVLYERLRKHTEASTLLGKIA
RNRRGIAIGIISVLFVSYLAAAQWIVPRADRKLSFLPLTEQIQTMQANGQEVALYQANER
TAGATVFYTHTLLKDLQTEAELTAFLAASPTHVALIAAETEPKAPLKVLKKMLVGRQDYY
FVAQ