Protein Info for AO353_05710 in Pseudomonas fluorescens FW300-N2E3

Annotation: (Fe-S)-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00273: iron-sulfur cluster-binding protein
  • amino acids 24 to 442 (419 residues), 489.9 bits, E=3.4e-151
• PF02589: LUD_dom
  • amino acids 76 to 300 (225 residues), 170.6 bits, E=1.1e-53
• PF13183: Fer4_8
  • amino acids 317 to 383 (67 residues), 47.8 bits, E=6.2e-16
• PF13534: Fer4_17
  • amino acids 318 to 383 (66 residues), 23.4 bits, E=2.4e-08
• PF11870: LutB_C
  • amino acids 391 to 477 (87 residues), 95.3 bits, E=8.5e-31

Best Hits

Swiss-Prot: 43% identical to LUTB_BACLD: Lactate utilization protein B (lutB) from Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46)

KEGG orthology group: None (inferred from 94% identity to pfo:Pfl01_0751)

MetaCyc: 41% identical to component of an iron-sulfur oxidase linked to L-lactate utilization (Bacillus subtilis subtilis 168)
L-lactate dehydrogenase. [EC: 1.1.1.27]

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Iron-sulfur cluster-binding subunit YkgF" in subsystem L-rhamnose utilization or Lactate utilization

MetaCyc Pathways

• Bifidobacterium shunt (15/15 steps found)
• superpathway of glucose and xylose degradation (16/17 steps found)
• heterolactic fermentation (16/18 steps found)
• homolactic fermentation (10/12 steps found)
• superpathway of anaerobic sucrose degradation (15/19 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (4/4 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• pyruvate fermentation to (S)-lactate (1/1 steps found)
• pyruvate fermentation to acetate and lactate II (3/4 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (5/13 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycolysis / Gluconeogenesis
• Propanoate metabolism
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.27

Sequence Analysis Tools

See A0A0N9WED8 at UniProt or InterPro

Protein Sequence (484 amino acids)

>AO353_05710 (Fe-S)-binding protein (Pseudomonas fluorescens FW300-N2E3)
MSTSTLIPTVAVEEDFRTRAHEALGDKQLRNNFRSAMDSLMAKRAASFSDAFEREHLRAL
GNAIRARALSKLPDLLEQLEQNLTRNGVTVHWAETVDEANGIVLSIIRAHEARQVIKGKS
MVSEEMEMNHVLAEQGVECLESDMGEFIVQLDHEKPSHIIMPAIHKNAGQVASLFHDKLG
VEYTKDVDQLIQIGRKVLRQKFFEADIGVSGVNFAVAETGTLLLVENEGNGRMSTTVPPV
HIAVTGIEKVVENLRDVVPLLSLLTRSALGQPITTYVNMISGPRKAHELDGPQEVHLVLL
DNGRSQAFADSELRQTLNCIRCGACMNHCPVYTRIGGHAYGEVYPGPIGKIITPHLVGLA
KVPDHPSASSLCGACGEVCPVKIPIPALLRRLREENVKAPDSPHQVMRGQGSKYSRKERF
IWNAWAKLNSSPTLYRLFGFFATRLRALTPNNIGPWTQNHSAPKPAARSLHDMAREHLAK
QGDR