Protein Info for AO353_05565 in Pseudomonas fluorescens FW300-N2E3

Annotation: transcription elongation factor NusA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 PF08529: NusA_N" amino acids 4 to 125 (122 residues), 125.9 bits, see alignment E=2e-40 TIGR01953: transcription termination factor NusA" amino acids 5 to 344 (340 residues), 403.2 bits, see alignment E=8.1e-125 PF00575: S1" amino acids 136 to 197 (62 residues), 28.8 bits, see alignment E=2.6e-10 PF13184: KH_5" amino acids 232 to 299 (68 residues), 95.3 bits, see alignment E=3.9e-31 TIGR01954: transcription termination factor NusA, C-terminal duplication" amino acids 367 to 415 (49 residues), 70.5 bits, see alignment 9.9e-24 amino acids 442 to 491 (50 residues), 64.8 bits, see alignment 6e-22 PF14520: HHH_5" amino acids 434 to 488 (55 residues), 40.7 bits, see alignment 5.2e-14

Best Hits

Swiss-Prot: 60% identical to NUSA_COXBU: Transcription termination/antitermination protein NusA (nusA) from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)

KEGG orthology group: K02600, N utilization substance protein A (inferred from 99% identity to pfs:PFLU5254)

Predicted SEED Role

"Transcription termination protein NusA" in subsystem NusA-TFII Cluster or Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7GZJ9 at UniProt or InterPro

Protein Sequence (493 amino acids)

>AO353_05565 transcription elongation factor NusA (Pseudomonas fluorescens FW300-N2E3)
MSKEVLLVVESVSNEKGVPANVIFEALELALATATKKRFEDEVDLRVEINRHTGAYETFR
RWTVVEEADLDDPAVETWPSKVQETHPGAKVGDVVEEKIESIEFGRIAAQTAKQVIVQKV
REAERAQVVDAYRERLGEIISGTVKKVTRDNVIVDLGNNAEALLAREDIISRETFRVGVR
LRALLKEIRTENRGPQLILSRTAPEMLIELFRIEVPEIAEGLIEVMAASRDPGSRAKIAV
RSKDKRIDPQGACIGMRGSRVQAVSGELGGERVDIVLWDDNPAQFVINAMSPAEVAAIIV
DEDAHAMDIAVGADNLAQAIGRGGQNVRLASQLTGWTLNVMTESDIQAKQQAETGDILRN
FIDELEVDEDLAQVLVDEGFTSLEEIAYVPLEEMLNIDGFDEDTVNELRARAKDRLLTKA
IATEEKLADAHPAEDLLSLEGMDKDLAMELAVRGVITREDLAEQSIDDLLDIDGIDDDRA
GKLIMAARAHWFE