Protein Info for AO353_05335 in Pseudomonas fluorescens FW300-N2E3

Annotation: chemotaxis protein CheY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 PF00072: Response_reg" amino acids 16 to 124 (109 residues), 77.1 bits, see alignment E=1.8e-25 PF02954: HTH_8" amino acids 148 to 181 (34 residues), 45 bits, see alignment 1.1e-15 PF13556: HTH_30" amino acids 152 to 181 (30 residues), 27.3 bits, see alignment 3.8e-10

Best Hits

Swiss-Prot: 52% identical to REGA_RHOSU: Photosynthetic apparatus regulatory protein RegA (regA) from Rhodovulum sulfidophilum

KEGG orthology group: K15012, two-component system, response regulator RegA (inferred from 97% identity to pfl:PFL_0885)

Predicted SEED Role

"Dna binding response regulator PrrA (RegA)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WE69 at UniProt or InterPro

Protein Sequence (186 amino acids)

>AO353_05335 chemotaxis protein CheY (Pseudomonas fluorescens FW300-N2E3)
MSDEIQVEGEELPHLLLVDDDATFTRVMARAMSRRGFRVSTAGSAEEGLTIAQADLPDFA
ALDLKMDGDSGLVLLPKLLELDPEMRVVILTGYSSIATAVEAIKRGACNYLCKPADADDV
LAALLSEHADLDTLVPENPMSVDRLQWEHIQRVLTEHEGNISATARALGMHRRTLQRKLQ
KRPVRR