Protein Info for AO353_05180 in Pseudomonas fluorescens FW300-N2E3

Annotation: RNA polymerase sigma-54 factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 PF00309: Sigma54_AID" amino acids 5 to 48 (44 residues), 62.3 bits, see alignment 4.5e-21 TIGR02395: RNA polymerase sigma-54 factor" amino acids 10 to 494 (485 residues), 512.6 bits, see alignment E=4.9e-158 PF04963: Sigma54_CBD" amino acids 129 to 323 (195 residues), 220 bits, see alignment E=3.3e-69 PF04552: Sigma54_DBD" amino acids 337 to 495 (159 residues), 232.7 bits, see alignment E=2.7e-73

Best Hits

Swiss-Prot: 91% identical to RP54_PSEPK: RNA polymerase sigma-54 factor (rpoN) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03092, RNA polymerase sigma-54 factor (inferred from 98% identity to pfs:PFLU0882)

Predicted SEED Role

"RNA polymerase sigma-54 factor RpoN" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7GZJ0 at UniProt or InterPro

Protein Sequence (497 amino acids)

>AO353_05180 RNA polymerase sigma-54 factor (Pseudomonas fluorescens FW300-N2E3)
MKPSLVLRMGQQLTMTPQLQQAIRLLQLSTLDLQQEIQEALESNPMLERQEEGDDFDNAD
PMADNIEQKPNTDIQEPSYQETAPTVDNLEEGDWNERIPNELPVDTAWEDVYQTSASSLP
SNDDDEWDFTTRTSAGESLQSHLLWQLNLAPMSDTDRLIAVTLIDCINNQGYLDETLEEI
LEAFDPELDIELDEIEAVLHRIQQFEPAGIGARNLSECLLLQLRQLPANTPWLAEAKRLV
IDYIDLLGSRDYSQLMRRMKLKEDELRQVIELVQSLNPRPGSQIESSEAEYVVPDVIVRK
DNERWLVELNQESVPRLRVNPQYAGFVRRADTSADNTFMRNQLQEARWFIKSLQSRNETL
MKVATQIVEHQRGFLEYGDEAMKPLVLHDIAEAVGMHESTISRVTTQKFMHTPRGIYELK
YFFSSHVSTSEGGECSSTAIRAIIKKLVAAENQKKPLSDSKIAGLLEAQGIQVARRTVAK
YRESLGIAPSSERKRLM