Protein Info for AO353_05115 in Pseudomonas fluorescens FW300-N2E3

Updated annotation (from data): ATP phosphoribosyltransferase (EC 2.4.2.17)
Rationale: Important for fitness in most defined media. Semi-automated annotation based on the auxotrophic phenotype and a hit to HMM TIGR00070.
Original annotation: ATP phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00070: ATP phosphoribosyltransferase
  • amino acids 2 to 182 (181 residues), 182.2 bits, E=4.6e-58
• PF01634: HisG
  • amino acids 51 to 202 (152 residues), 176.7 bits, E=1.7e-56

Best Hits

Swiss-Prot: 97% identical to HIS1_PSEPF: ATP phosphoribosyltransferase (hisG) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K00765, ATP phosphoribosyltransferase [EC: 2.4.2.17] (inferred from 94% identity to pen:PSEEN1106)

Predicted SEED Role

"ATP phosphoribosyltransferase (EC 2.4.2.17)" in subsystem Histidine Biosynthesis (EC 2.4.2.17)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Histidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.17

Use Curated BLAST to search for 2.4.2.17

Sequence Analysis Tools

See A0A0N9WFS4 at UniProt or InterPro

Protein Sequence (211 amino acids)

>AO353_05115 ATP phosphoribosyltransferase (EC 2.4.2.17) (Pseudomonas fluorescens FW300-N2E3)
MLTIALSKGRILDDTLPLLAEAGIVPTENPDKSRKLIIPTTQADVRLLIVRATDVPTYVE
HGAADLGVAGKDVLMEYGGQGLYEPLDLQIAQCKLMTAGKVGAVEPKGRLRIATKFVNVA
KRYYAEQGRQVDIIKLYGSMELAPLIGLADKIIDVVDTGNTLRANGLEPQDFIAAISSRL
IVNKASMKMQHARIQALIDTLRKAVESRHRG