Protein Info for AO353_04890 in Pseudomonas fluorescens FW300-N2E3
Annotation: biopolymer transporter ExbB
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 89% identity to pfl:PFL_0993)Predicted SEED Role
"Ferric siderophore transport system, biopolymer transport protein ExbB" in subsystem Campylobacter Iron Metabolism or Ton and Tol transport systems
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0N7GZI3 at UniProt or InterPro
Protein Sequence (214 amino acids)
>AO353_04890 biopolymer transporter ExbB (Pseudomonas fluorescens FW300-N2E3) MDMNLLHDITFYTLYGAAAIAAFIAVERGIYFSFSLRQAKKLEAVLNPTMHAVEDLPAAL CQRNSLPLEMLETLFAHKQGLATHKDLEDLSESIYISTRSKLMHGLWLLETVVTAAPLLG LLGTILGIIDTFKALAETGVSDPGEVSKGIGTALYATALGIAVALGSMIFHNHFQDRVER ITDHLKILLLRAGMGTTLKQVEVPQAIHGQLQSA