Protein Info for AO353_04715 in Pseudomonas fluorescens FW300-N2E3

Annotation: poly(beta-D-mannuronate) lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF05426: Alginate_lyase" amino acids 64 to 305 (242 residues), 223.1 bits, see alignment E=2.5e-70

Best Hits

Swiss-Prot: 91% identical to ALGL_PSEPF: Alginate lyase (algL) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K01729, poly(beta-D-mannuronate) lyase [EC: 4.2.2.3] (inferred from 91% identity to pfo:Pfl01_0953)

Predicted SEED Role

"Alginate lyase precursor (EC 4.2.2.3)" in subsystem Alginate metabolism (EC 4.2.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.2.3

Use Curated BLAST to search for 4.2.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WC08 at UniProt or InterPro

Protein Sequence (374 amino acids)

>AO353_04715 poly(beta-D-mannuronate) lyase (Pseudomonas fluorescens FW300-N2E3)
MRNQKLKTLLAPTLLSLAMFAGATHAATPLRPPQGYFAPVDKFKNGDSSEGCDAMPTPYT
GALQFRSKYEGSDKARSTLNVASEKAFRDTTADITTLERGTSKRVMQFMRDGRPEQLECT
LNWLTAWAKADALMSRDFNHTGKSMRKWALGSMASAYIRLKFSDSHPLATHQQEAQVIEA
WFSKMADQVVSDWDNLPLEQTNNHSYWAAWSVMATSVATNRHDLFDWAVKEYKVGANQVD
AQGFLPNELKRQQRALAYHNYALPPLAMIASFAQANGVDLRQENNGALKRLGDRVLAGVK
DPQTFEQKNGKEQDMTDLKVDSKFAWLEPFCTLYTCPADVLERKHAMQPFKSFRLGGDLT
KVYDPSHEKGNKGS