Protein Info for AO353_04490 in Pseudomonas fluorescens FW300-N2E3

Annotation: murein transglycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF00497: SBP_bac_3" amino acids 43 to 266 (224 residues), 112.9 bits, see alignment E=1.7e-36 PF01464: SLT" amino acids 293 to 400 (108 residues), 79.7 bits, see alignment E=1.3e-26

Best Hits

Swiss-Prot: 92% identical to MLTF_PSEPF: Membrane-bound lytic murein transglycosylase F (mltF) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: None (inferred from 92% identity to pfo:Pfl01_0998)

Predicted SEED Role

"Transglycosylase, Slt family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VQD1 at UniProt or InterPro

Protein Sequence (486 amino acids)

>AO353_04490 murein transglycosylase (Pseudomonas fluorescens FW300-N2E3)
MFSPTALRPRFAKWLIATGLFLMLSGCVDKPNTLERVKEDGVLRVVTRNSPATYFQDRNG
ETGFEYELVKRFADDLGVKLKIETADNLDDLYGQLGKPGGPVLAAAGLVGSDKRKQQVRF
SHSYLEVTPQIIYRNGQSRPTSAADLVGKTIMVLKGSTHADQLAALKKKYPGIEYEESDA
VEVVDLLRMVDEGQIDLTLVDSNEVAMNQVYFTNARVAFDLGDASNQSWAVAAGDDNSLL
NEINDFLDKAQKNGTLQRLKDRYYGHVDVLGYMGAYTFAEHLQQRLPKYEKHFKASAKEE
KVDWRLLAAIGYQESLWQPAVTSKTGVRGLMMLTQNTAQAMGVSNRLDAKQSIMGGAKYL
AYTKDQLDDSIQEPDRTWFALAAYNVGSGHLDDARKLAAKEGLNPDKWLDVKKILPRLSQ
KQWYSKTRYGYARGGEPVHFVANIRRYYDILTWVTQPQLEGDQVTQGNLHVPGIDKTKPP
EENPPL