Protein Info for AO353_04465 in Pseudomonas fluorescens FW300-N2E3

Updated annotation (from data): N-acetylglucosamine-specific PTS system, IIBC components (nagE)
Rationale: Specifically important for NAG utilization. SEED incorrectly implies that this contains the IIA component as well. (KEGG_correct)
Original annotation: PTS N-acetyl-D-glucosamine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 571 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 46 to 67 (22 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 97 to 114 (18 residues), see Phobius details amino acids 134 to 155 (22 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 198 to 220 (23 residues), see Phobius details amino acids 232 to 252 (21 residues), see Phobius details amino acids 262 to 279 (18 residues), see Phobius details amino acids 285 to 306 (22 residues), see Phobius details amino acids 313 to 332 (20 residues), see Phobius details amino acids 338 to 359 (22 residues), see Phobius details TIGR01998: PTS system, N-acetylglucosamine-specific IIBC component" amino acids 9 to 457 (449 residues), 566.8 bits, see alignment E=3.6e-174 PF02378: PTS_EIIC" amino acids 14 to 303 (290 residues), 242.5 bits, see alignment E=6e-76 TIGR00826: PTS system, glucose-like IIB component" amino acids 360 to 445 (86 residues), 50.1 bits, see alignment E=2.8e-17 PF00367: PTS_EIIB" amino acids 389 to 419 (31 residues), 38.5 bits, see alignment (E = 5.9e-14)

Best Hits

KEGG orthology group: K02803, PTS system, N-acetylglucosamine-specific IIB component [EC: 2.7.1.69] K02804, PTS system, N-acetylglucosamine-specific IIC component (inferred from 87% identity to pfo:Pfl01_1003)

Predicted SEED Role

"PTS system, N-acetylglucosamine-specific IIA component (EC 2.7.1.69) / PTS system, N-acetylglucosamine-specific IIB component (EC 2.7.1.69) / PTS system, N-acetylglucosamine-specific IIC component (EC 2.7.1.69)" in subsystem Chitin and N-acetylglucosamine utilization or Sialic Acid Metabolism (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VKH1 at UniProt or InterPro

Protein Sequence (571 amino acids)

>AO353_04465 N-acetylglucosamine-specific PTS system, IIBC components (nagE) (Pseudomonas fluorescens FW300-N2E3)
MYQLFIEGLQRLGRALMLPIAILPIAGLLLRLGDTDLLNIAIIHDAGQVIFANLALIFAI
GIAVGFARDNNGTAGLAGAIGYLVMVSTLKVLDASINMGMLAGIISGLMAGALYNRFKDI
KLPEYLAFFGGRRFVPIATGFSAVGLGVIFGLIWPPIQHGINSFGQLLLESGSIGAFVFG
VFNRLLIVTGLHHILNNMAWFIFGSFTDPTTGAIVTGDLARYFAGDPKGGQFMTGMFPMM
IFGLPAACLAMYRNALPERRKVMGGIFLSMALTSFLTGVTEPIEFAFMFLAPLLYLLHVL
LTGMAMAITNALNIHLGFTFSGGAIDMALGWGKSTNGWLVFPVGLAYAVIYYVVFDFCIR
RFNLKTPGREGVVVGEKVVLSENQRAGAYIQALGGAENLITVGACTTRLRLEMVDRNKAS
DSELKALGAMAVVRPGKGGSLQVVVGPLADSIADEIRQAMPTAGSALVAAVVVTEEAPKA
APVETPEAQKWLNAVGGSDNVLQLDCVAMTRIRLQLADGKALSECQLKDLGCQGVSALDG
GVWHLLIGDKALSLSEALEGLVNRSEVSAKV