Protein Info for AO353_04455 in Pseudomonas fluorescens FW300-N2E3

Updated annotation (from data): Glucosamine-6-phosphate deaminase [isomerizing], alternative (EC 3.5.99.6)
Rationale: Specifically important for utilizing N-Acetyl-D-Glucosamine. Automated validation from mutant phenotype: the predicted function (GLUCOSAMINE-6-P-DEAMIN-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: iron dicitrate transport regulator FecR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01380: SIS
  • amino acids 40 to 154 (115 residues), 57.2 bits, E=8.3e-20
  • amino acids 194 to 277 (84 residues), 52.2 bits, E=2.8e-18

Best Hits

KEGG orthology group: K01504, glucosamine-6-phosphate isomerase [EC: 3.5.99.6] (inferred from 91% identity to pfo:Pfl01_1005)

Predicted SEED Role

"Glucosamine-6-phosphate deaminase [isomerizing], alternative (EC 3.5.99.6)" in subsystem Chitin and N-acetylglucosamine utilization or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 3.5.99.6)

MetaCyc Pathways

• N-acetylglucosamine degradation I (2/2 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• N-acetylglucosamine degradation II (2/3 steps found)
• superpathway of N-acetylneuraminate degradation (15/22 steps found)
• superpathway of N-acetylglucosamine, N-acetylmannosamine and N-acetylneuraminate degradation (2/6 steps found)
• chitin degradation I (archaea) (2/7 steps found)
• chitin derivatives degradation (2/8 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.99.6

Sequence Analysis Tools

See A0A0N9VQW1 at UniProt or InterPro

Protein Sequence (336 amino acids)

>AO353_04455 Glucosamine-6-phosphate deaminase [isomerizing], alternative (EC 3.5.99.6) (Pseudomonas fluorescens FW300-N2E3)
MLEEALSSYKAVDAQLQQLDPLMIEIAGRLNRQPPQVAMTVARGSSDHAASYFAYLTMQH
VGIPVASLPMSVVTMQQAPLKVSGQAVFAFSQSGQSPDLVNSLRLLRKRGALSISMVNAE
NSPLEAACEFSLPLCAGTESSVAATKSFIATLSASARLIAYWKQDPELLQAGLALPEGLR
DAATQDWSLAVDVLRDCQRLMVIGRGAGFAIAQEAALKLKETSAIQAEAFSSAEVKHGPM
ALIDDNYPLLVFAPRGAEQAGLLSLAAEMRQRGARVLLAAPDDVSERDLTLSRAEHPALD
PILAIQSFYVMAAGLAVARGMDPDQPRHLSKVTRTH