Protein Info for AO353_04400 in Pseudomonas fluorescens FW300-N2E3

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 52 to 78 (27 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details amino acids 123 to 145 (23 residues), see Phobius details PF01595: CNNM" amino acids 13 to 149 (137 residues), 52.9 bits, see alignment E=5.7e-18 PF00571: CBS" amino acids 265 to 314 (50 residues), 28.8 bits, see alignment 1.9e-10 PF03471: CorC_HlyC" amino acids 331 to 403 (73 residues), 61.5 bits, see alignment E=9.5e-21

Best Hits

KEGG orthology group: None (inferred from 81% identity to pfo:Pfl01_1016)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VQV3 at UniProt or InterPro

Protein Sequence (421 amino acids)

>AO353_04400 transporter (Pseudomonas fluorescens FW300-N2E3)
MDNLPIGPLLAVLALLILWSGLFTAIEAAQQHLLTQRTASRSGDKPVAKLNFPLNSLIFC
NTLCRALVVVISTLLAIFGWAEKGPWLACLSATAALLVFADYLPRTLASRYPDTILALGN
TLLGVPLKIIYPAAWLLGGISQLLLKPFARKIKVVQQSEDEPPAPQNDGTDHEHPACRPH
ALSGIHALDNITVNDILVPRSEVDGINLDDSIEEIIEQLRANKRTRLPVFHSDINQVEAV
LNTRQIRHLLPDASLTKEALLAACHEPYFVPESTPLQLQLLNFHKQQRRLGMVVDEYGEV
EGIVTLEDILEEIVGEFESQHSLDNPHIHPQADGRLVIEGAASIRELNKSLGWHLPSDGP
KTLNGLVTEALETIPDSAVCLKIGRYRLEILETEDNRVSRVLIWHVAAGEATSLRSAAKP
L