Protein Info for AO353_04065 in Pseudomonas fluorescens FW300-N2E3

Annotation: electron transporter RnfB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 TIGR01944: electron transport complex, RnfABCDGE type, B subunit" amino acids 2 to 135 (134 residues), 219.7 bits, see alignment E=1.2e-69 PF04060: FeS" amino acids 11 to 42 (32 residues), 46.1 bits, see alignment (E = 6.5e-16) PF14697: Fer4_21" amino acids 74 to 128 (55 residues), 68.4 bits, see alignment 9.8e-23 PF13237: Fer4_10" amino acids 76 to 122 (47 residues), 27.9 bits, see alignment 3.6e-10 PF00037: Fer4" amino acids 76 to 96 (21 residues), 22.5 bits, see alignment (E = 1.5e-08)

Best Hits

KEGG orthology group: K03616, electron transport complex protein RnfB (inferred from 79% identity to pfo:Pfl01_4509)

Predicted SEED Role

"Electron transport complex protein RnfB" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W1M6 at UniProt or InterPro

Protein Sequence (404 amino acids)

>AO353_04065 electron transporter RnfB (Pseudomonas fluorescens FW300-N2E3)
MSLIQRIDALLPQTQCGKCGHPGCKPYAEGIANGEAINKCPPGGNETISALAELLKIPVL
ELDTSRGSAPAQIAFIREAECIGCTKCIQACPIDAIVGAAKLMHTVLIDECTGCDLCVAP
CPVDCIEMHPLPSTQVLPIIGGLAFTPEELQARNAKRDHARQRFEQRNARLRREEEQKHA
ERLARAQKAAQHSDASNTPLQDAIARVQAQKAAAADAALKKAKIDVAMSRAQLNKSLKAF
GHPPTFEQQSQLIILQQQFEAAEQALTQLESTVPSAPVQPTAPANDAELKRAKIQLAMRR
AELKKAQASEAPAEQLEALSAALAQAEQALHAAEGASEKPAPDLVRVEKRPIDAQLRQLK
TELAYARADVSKLERGPDTPAELLAKARERLCEAERQVNAYVAP