Protein Info for AO353_04060 in Pseudomonas fluorescens FW300-N2E3

Annotation: NADH:quinone oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 108 to 126 (19 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details PF02508: Rnf-Nqr" amino acids 6 to 193 (188 residues), 60.2 bits, see alignment E=1.4e-20

Best Hits

KEGG orthology group: K03617, electron transport complex protein RnfA (inferred from 71% identity to pfo:Pfl01_4508)

Predicted SEED Role

"Electron transport complex protein RnfA" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7GZG3 at UniProt or InterPro

Protein Sequence (195 amino acids)

>AO353_04060 NADH:quinone oxidoreductase (Pseudomonas fluorescens FW300-N2E3)
MTDILLTLISTALINNFIVHWPLGVDPLMQSTREPAIERRQVHALGIATTCLMLLSGVPG
YAAYHWLLIPLGLTSLYLFVFLPLSVLLITPLLNLLTRALPQLPFNGLWPLLLGNAGVLG
LSLFGMQSDKGFGYHVALCLGAGLGFWLVLSLFSDLRQRILNNDVPLPFRGLPIDLISAG
LVAVAFLGFSGLIKT