Protein Info for AO353_03965 in Pseudomonas fluorescens FW300-N2E3

Annotation: type IV secretion protein Rhs

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 674 TIGR03361: type VI secretion system Vgr family protein" amino acids 10 to 521 (512 residues), 599.3 bits, see alignment E=5.9e-184 TIGR01646: Rhs element Vgr protein" amino acids 22 to 504 (483 residues), 345 bits, see alignment E=8e-107 PF05954: Phage_GPD" amino acids 29 to 321 (293 residues), 252.9 bits, see alignment E=4.2e-79 PF04717: Phage_base_V" amino acids 386 to 451 (66 residues), 54.8 bits, see alignment E=9.7e-19

Best Hits

KEGG orthology group: None (inferred from 72% identity to pst:PSPTO_3482)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WE84 at UniProt or InterPro

Protein Sequence (674 amino acids)

>AO353_03965 type IV secretion protein Rhs (Pseudomonas fluorescens FW300-N2E3)
MFDSANTVHFALQIPAVRNDFKVLAFDGTEAISALYAIQVELVSENPDFDLESLLAQPAF
LQFGHNGEGLHGHIEEVFVGETGRRLTRYRLTLVPTLHYLQFSHDQRIFQNLTVPQIIAK
VFKGHGVQADAFIFHVSTSPVRKYCTQYGESDFEFIQRLCAEDGIAWHHQHSPDGHVLVF
TDDQVFFPKLGETPYQQDAGMVAEHPVVNQFSLRFSTRTSTVTRRDYDLIRPSLLLESRF
TAEFSPELEDYRYPVRMDTEERGKQLARQALERHRTDYQLAEGNSDQPTLRSGHFFDLTE
HPRKTCNDLWLLVSVQHVGRQPQSLEEAITSDATPESGFTQGYRNRFSAIASYVLYRPPL
PPRKPVLVCQTARVTGPPGEEIFCDEYGRVKVEFPWCRAELNSEKSSCWLRVASSWAGEG
FGAVTIPRVGMEVVVTFQEGDPDQPLITGCVVNKVTSVAHQLPKNKTRTVLRSQSSPRSS
GGYSELSIEDRAGQEKIYLRAQRDIEQLILNDSHCLISNNRFEQVHKNSTSLIKGDELHT
TQGVRNTVIGGDELITITGNSSTTAEGTLVIKAGQQARVTATNVVIDAGMSLTLKAGGHH
IVINASGIFSSVAIVEGGAPMAGIAPEPARSLLPVAPQALITPSLAVQKQALTEAAQQAA
PICAVCQKLAETSA