Protein Info for AO353_03930 in Pseudomonas fluorescens FW300-N2E3

Annotation: superoxide dismutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00081: Sod_Fe_N
  • amino acids 3 to 82 (80 residues), 115.8 bits, E=1e-37
• PF02777: Sod_Fe_C
  • amino acids 89 to 189 (101 residues), 137.6 bits, E=1.4e-44

Best Hits

Swiss-Prot: 96% identical to SODF_PSEPU: Superoxide dismutase [Fe] (sodB) from Pseudomonas putida

KEGG orthology group: K04564, superoxide dismutase, Fe-Mn family [EC: 1.15.1.1] (inferred from 95% identity to ppw:PputW619_0981)

MetaCyc: 70% identical to superoxide dismutase (Fe) (Escherichia coli K-12 substr. MG1655)
Superoxide dismutase. [EC: 1.15.1.1]

Predicted SEED Role

"Superoxide dismutase [Fe] (EC 1.15.1.1)" in subsystem Oxidative stress (EC 1.15.1.1)

MetaCyc Pathways

• reactive oxygen species degradation (4/4 steps found)
• ethene biosynthesis III (microbes) (6/7 steps found)
• superoxide radicals degradation (2/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.15.1.1

Sequence Analysis Tools

See A0A0N9WF25 at UniProt or InterPro

Protein Sequence (198 amino acids)

>AO353_03930 superoxide dismutase (Pseudomonas fluorescens FW300-N2E3)
MAFELPPLPYAHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEQIVKTS
SGGIFNNAAQVWNHTFYWNCMAPNAGGQPTGALADAINAAFGSFDKFKEEFTKTSIGTFG
SGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWN
LVNWKFVAEQFEGKTFTA