Protein Info for AO353_03790 in Pseudomonas fluorescens FW300-N2E3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 transmembrane" amino acids 14 to 33 (20 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 89 to 92 (4 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 120 to 138 (19 residues), see Phobius details amino acids 150 to 172 (23 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 200 to 360 (161 residues), 134.3 bits, see alignment E=1.7e-43 PF00990: GGDEF" amino acids 205 to 358 (154 residues), 143.1 bits, see alignment E=3.3e-46

Best Hits

KEGG orthology group: None (inferred from 78% identity to pfo:Pfl01_4451)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WE53 at UniProt or InterPro

Protein Sequence (368 amino acids)

>AO353_03790 hypothetical protein (Pseudomonas fluorescens FW300-N2E3)
LTHNALQSLLLKRFILATGTYALVLLLLWLAILSGHYQGSVRSAVIGTVLVILSQTVLFA
LFFTGRNLRFADPGLTEVQVLLGLGWQTWLIAHLDSARGAFLVFYLLILLFGLFHLPRQA
FIRCAALVFFSFAGLNLWEGYHLEPVDPALAALQVCVLFIVLVWLTLYAGYVQTSRQRMR
KRRFALQAHQDTLRGMMRQLEDLVATDELTGLFNRRHFLRLTTRELRSMEEGTVHGLALI
DLDYFKRINDKYGHAAGDQVLQAFAGVATACLREDDVLARYGGEEFVLLLPDCDPERLTS
CCERLRIAFTEVELVGLPVQDLSLSAGMTLLESGDDLDGALQRADQALYRAKRDGRNRCA
AAWENADA