Protein Info for AO353_03785 in Pseudomonas fluorescens FW300-N2E3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 PF00111: Fer2" amino acids 12 to 76 (65 residues), 62.2 bits, see alignment E=5.5e-21 PF00970: FAD_binding_6" amino acids 102 to 175 (74 residues), 21.7 bits, see alignment E=3.2e-08 PF00175: NAD_binding_1" amino acids 196 to 254 (59 residues), 30.3 bits, see alignment E=8.6e-11

Best Hits

KEGG orthology group: None (inferred from 82% identity to pfl:PFL_4799)

Predicted SEED Role

"2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases" in subsystem Central meta-cleavage pathway of aromatic compound degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VPZ6 at UniProt or InterPro

Protein Sequence (311 amino acids)

>AO353_03785 hypothetical protein (Pseudomonas fluorescens FW300-N2E3)
MPDLRVGELQWSVAAGSNLLDALNQKGMHVPYSCRAGSCHACMVHCLKGEVSDRRPDALS
AEQREQGWRLACQCEVVDDLHVAVFDPLRDGLPATVEAADWLSPSVLRLRLQPERPLRYQ
AGQHLVLWAGNVARPYSLASLPQEDRFLEFHLDCRLPGEFSDAARLLKIGDPIRLGELRG
GALHYDPDWQTQPLWLLATGTGLAPLFGVLREALRQDHQGPIRVIHLAHDASEHYLAKPL
AALAAQRPNLSVELLTAAELTVALAQLRLVSRQTLALLCGHPDSVDAFARRLYLAGLPRN
QLLADVFVPRG