Protein Info for AO353_03780 in Pseudomonas fluorescens FW300-N2E3

Annotation: enoyl-CoA hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00378: ECH_1
  • amino acids 9 to 235 (227 residues), 161.1 bits, E=3.1e-51
• PF16113: ECH_2
  • amino acids 15 to 218 (204 residues), 100.9 bits, E=1.1e-32

Best Hits

Swiss-Prot: 33% identical to ECHA8_MYCBO: Probable enoyl-CoA hydratase echA8 (echA8) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 84% identity to pfo:Pfl01_4449)

Predicted SEED Role

"Enoyl-CoA hydratase (EC 4.2.1.17)" in subsystem Acetyl-CoA fermentation to Butyrate or Butanol Biosynthesis or Isoleucine degradation or Polyhydroxybutyrate metabolism or Valine degradation or n-Phenylalkanoic acid degradation (EC 4.2.1.17)

MetaCyc Pathways

• oleate β-oxidation (30/35 steps found)
• fatty acid salvage (6/6 steps found)
• adipate degradation (5/5 steps found)
• 2-methyl-branched fatty acid β-oxidation (11/14 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• L-isoleucine degradation I (5/6 steps found)
• valproate β-oxidation (7/9 steps found)
• adipate biosynthesis (4/5 steps found)
• fatty acid β-oxidation IV (unsaturated, even number) (4/5 steps found)
• L-valine degradation I (6/8 steps found)
• fatty acid β-oxidation I (generic) (5/7 steps found)
• propanoate fermentation to 2-methylbutanoate (4/6 steps found)
• pyruvate fermentation to butanol II (engineered) (4/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
• glutaryl-CoA degradation (3/5 steps found)
• pyruvate fermentation to hexanol (engineered) (7/11 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (4/7 steps found)
• L-glutamate degradation V (via hydroxyglutarate) (6/10 steps found)
• methyl ketone biosynthesis (engineered) (3/6 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (5/9 steps found)
• glycerol degradation to butanol (10/16 steps found)
• pyruvate fermentation to butanol I (4/8 steps found)
• (8E,10E)-dodeca-8,10-dienol biosynthesis (6/11 steps found)
• benzoyl-CoA degradation I (aerobic) (3/7 steps found)
• pyruvate fermentation to butanoate (3/7 steps found)
• benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (1/5 steps found)
• 3-phenylpropanoate degradation (4/10 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (6/13 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
• phenylacetate degradation I (aerobic) (3/9 steps found)
• superpathway of phenylethylamine degradation (4/11 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (8/17 steps found)
• L-tryptophan degradation III (eukaryotic) (6/15 steps found)
• gallate degradation III (anaerobic) (3/11 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (8/18 steps found)
• L-glutamate degradation VII (to butanoate) (3/12 steps found)
• (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (3/13 steps found)
• docosahexaenoate biosynthesis III (6-desaturase, mammals) (3/14 steps found)
• crotonate fermentation (to acetate and cyclohexane carboxylate) (3/16 steps found)
• benzoate fermentation (to acetate and cyclohexane carboxylate) (3/17 steps found)
• toluene degradation VI (anaerobic) (3/18 steps found)
• Spodoptera littoralis pheromone biosynthesis (4/22 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation
• alpha-Linolenic acid metabolism
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.17

Sequence Analysis Tools

See A0A0N9WBF5 at UniProt or InterPro

Protein Sequence (249 amino acids)

>AO353_03780 enoyl-CoA hydratase (Pseudomonas fluorescens FW300-N2E3)
MTNAILLERERGLLTLRLNRPDKKNALTRAMYSQLADALLQADADPEINAILITGTRECF
TAGNDIADFLEEPPSDLTSPVFQFMRNLLECRKPVIAAVAGAAVGIGTTLLLHCDLVYIS
ADAKLRMPFVNLGLCPEFGSSLILPRLLGQAKAAELLLLGEGFNGEQAAAWGIATQALPT
GEAALAKAREMALRFETLAPEAVRISKQLMKAPDREQLRKAIEEEGNLFVQRLRSPEAIA
ALSGFINRA