Protein Info for AO353_03730 in Pseudomonas fluorescens FW300-N2E3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 transmembrane" amino acids 82 to 98 (17 residues), see Phobius details amino acids 104 to 126 (23 residues), see Phobius details amino acids 183 to 209 (27 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details amino acids 269 to 289 (21 residues), see Phobius details amino acids 301 to 318 (18 residues), see Phobius details PF01944: SpoIIM" amino acids 109 to 290 (182 residues), 124.6 bits, see alignment E=2e-40

Best Hits

KEGG orthology group: None (inferred from 75% identity to pfo:Pfl01_4440)

Predicted SEED Role

"FIG01248689: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VW04 at UniProt or InterPro

Protein Sequence (326 amino acids)

>AO353_03730 hypothetical protein (Pseudomonas fluorescens FW300-N2E3)
MKQSLFENRHRAEWDQFSQRLDLLERGKANALDGTSFPKDYRRLCQHLALAQERGYSSYL
IDPLQQLVLRGHQQLYRHRGRVGAHLLAFVLAGFPRLVREQWPFVLVSSLLFFGSLVGIG
VLVYLYPELVYSLVPAGQVSEMQSMYDPAAGHLGRLGERAASDDWVMFGYYIMHNIGIAF
QTYASGLLFGLGSAFFLFFNGLMIGAVAGHLTHIGYGENFWSFVVGHGAFELSAIALAGA
AGLQLGWALIAPGRLPRGEALRRAAHKSVLMICGVMLFLLLAAFIEAYWSSRAGLAPPIK
YLVGAALWVVMAIYLIFAGRTRHAPE