Protein Info for AO353_03645 in Pseudomonas fluorescens FW300-N2E3

Annotation: 2-dehydropantoate 2-reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR00745: 2-dehydropantoate 2-reductase" amino acids 4 to 293 (290 residues), 248.2 bits, see alignment E=5.6e-78 PF02558: ApbA" amino acids 5 to 152 (148 residues), 126.9 bits, see alignment E=5.1e-41 PF08546: ApbA_C" amino acids 176 to 291 (116 residues), 92.3 bits, see alignment E=3.1e-30

Best Hits

Swiss-Prot: 68% identical to PANE_PSEAE: Probable 2-dehydropantoate 2-reductase (panE) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00077, 2-dehydropantoate 2-reductase [EC: 1.1.1.169] (inferred from 86% identity to pfo:Pfl01_4422)

Predicted SEED Role

"2-dehydropantoate 2-reductase (EC 1.1.1.169)" in subsystem Coenzyme A Biosynthesis (EC 1.1.1.169)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.169

Use Curated BLAST to search for 1.1.1.169

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7GZF3 at UniProt or InterPro

Protein Sequence (305 amino acids)

>AO353_03645 2-dehydropantoate 2-reductase (Pseudomonas fluorescens FW300-N2E3)
MSTTWHVLGAGSLGTLWATRLARAGLPVKLILRDTARLQAYQAAGGLTLVEQGEARQYAI
PGETVDSAGPIDRLLVACKAYDAESAVAQLAARLAPNAELILLQNGLGSQDAVAARVPQA
RCIFASSTEGAFRDDDWRVVFAGHGYTWLGDASHPTPPIWLDDLSAAGIPHEWSTDILTR
LWRKLALNCAINPLTVLHDCRNGGLQQHHCEVATLCAELSELLERCGQPAAAHNLQQEVE
RVIQATAANYSSMYQDVASQRRTEISYLLGHACTAASRHQLVLPHLNQLQQRLITHLHAR
GLPSD