Protein Info for AO353_03635 in Pseudomonas fluorescens FW300-N2E3

Annotation: mechanosensitive ion channel protein MscS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 transmembrane" amino acids 24 to 42 (19 residues), see Phobius details amino acids 63 to 87 (25 residues), see Phobius details amino acids 93 to 123 (31 residues), see Phobius details PF21088: MS_channel_1st" amino acids 71 to 109 (39 residues), 24.9 bits, see alignment 2.5e-09 PF00924: MS_channel_2nd" amino acids 111 to 177 (67 residues), 73 bits, see alignment E=2.6e-24 PF21082: MS_channel_3rd" amino acids 183 to 264 (82 residues), 57.9 bits, see alignment E=1.7e-19

Best Hits

Swiss-Prot: 38% identical to Y402_BUCBP: Uncharacterized MscS family protein bbp_402 (bbp_402) from Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)

KEGG orthology group: K03442, small conductance mechanosensitive channel (inferred from 91% identity to pfl:PFL_4774)

MetaCyc: 37% identical to small conductance mechanosensitive channel MscS (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-86

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VK16 at UniProt or InterPro

Protein Sequence (278 amino acids)

>AO353_03635 mechanosensitive ion channel protein MscS (Pseudomonas fluorescens FW300-N2E3)
MDINAEVDNLVKASQAWIPMIMEYGSRVLLAAITLAIGWWLINKLTHKVGKLLALRNADL
ALQGFMSSLANIILKVLLMVSVASMIGVETTSFVAAIGAAGLAIGLALQGSLANFAGGVL
ILLFRPFRIGDVIEAQGITGTVDSIQIFHTLLRTGDNKTVIVPNGNLSNGIITNHNRQQT
RKVVFDIAVNYDADLQKAREVLLELAKDERVLADPAPVAVVSTLGDSSITVSLRVWVKTA
DYWDVMFMFNEHARDRLKAAGIDIPYPQRMIRMVQETA