Protein Info for AO353_03555 in Pseudomonas fluorescens FW300-N2E3

Annotation: translocation protein TolB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 TIGR02800: Tol-Pal system beta propeller repeat protein TolB" amino acids 5 to 415 (411 residues), 521.9 bits, see alignment E=6.1e-161 PF04052: TolB_N" amino acids 11 to 113 (103 residues), 102.4 bits, see alignment E=2.9e-33 PF07676: PD40" amino acids 181 to 214 (34 residues), 28.8 bits, see alignment 1.9e-10 amino acids 223 to 258 (36 residues), 51.1 bits, see alignment 1.8e-17 amino acids 268 to 302 (35 residues), 50.8 bits, see alignment 2.2e-17

Best Hits

Swiss-Prot: 96% identical to TOLB_PSEF5: Tol-Pal system protein TolB (tolB) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K03641, TolB protein (inferred from 96% identity to pfl:PFL_4758)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7GZF1 at UniProt or InterPro

Protein Sequence (419 amino acids)

>AO353_03555 translocation protein TolB (Pseudomonas fluorescens FW300-N2E3)
MAGIAAADEKNILVTSGSDRATPIAVVPFGWQGGSVLPDDMAEIIGNDLRNSGYYSPIPK
QNMISQPTSASEVIYRDWKALGAQYIMVGSIVPAGGRLQVQYALFNVATEQQVLTGSVSG
GVDQLRDMAHYISDQSFEKLTGIKGAFSTRLLYVTAERFSVNNTRYTLQRSDYDGARAVT
LLQSREPILSPRFAPDGKRIAYVSFEQKRPRIFMQNIDTGRREQITNFEGLNGAPAWSPD
GTRLAFVLSKDGNPDIYVMNLGSRQINRVTAGPGINTEPFWGKDGSTIYFTSDRGGKPQI
YKTNVNGGGAERVTFIGNYNANPKLSADEKTLVMIHRQDGFTNFRVAAQDLQRGSVKILT
DTNLDESATVAPNGTMVIYATAQQGRGVLMLVSINGRVRLPLPTAQGEVREPSWSPYLN