Protein Info for AO353_03545 in Pseudomonas fluorescens FW300-N2E3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF16331: TolA_bind_tri" amino acids 66 to 117 (52 residues), 34.2 bits, see alignment 7.4e-12 TIGR02795: tol-pal system protein YbgF" amino acids 157 to 274 (118 residues), 135.6 bits, see alignment E=6.2e-44 PF13525: YfiO" amino acids 158 to 264 (107 residues), 34.2 bits, see alignment E=8.2e-12 PF13432: TPR_16" amino acids 161 to 226 (66 residues), 36.4 bits, see alignment E=2.1e-12 PF13174: TPR_6" amino acids 162 to 190 (29 residues), 16.6 bits, see alignment (E = 3.5e-06) amino acids 196 to 226 (31 residues), 17.7 bits, see alignment 1.5e-06 amino acids 232 to 263 (32 residues), 21 bits, see alignment 1.3e-07

Best Hits

Swiss-Prot: 81% identical to CPOB_PSEPK: Cell division coordinator CpoB (cpoB) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 89% identity to pfo:Pfl01_4400)

Predicted SEED Role

"TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WD84 at UniProt or InterPro

Protein Sequence (277 amino acids)

>AO353_03545 hypothetical protein (Pseudomonas fluorescens FW300-N2E3)
MRTCRRAVTVLALSLAPLAVWAAVPVVDDNSGYNNSGSSYPPAGYGTNGAYAGGGVTAPA
SAQGVLFNQLQQMQEQIARQQGAIEVLQNDVARMKQENLERYQDLDRRIGTGGAPAAAPQ
NSPAGGDMNNAAGAAAGASAATQAPAASSEPGDPAKEKLYYDAAFDLIKAKDFDKASQAF
AAFLRKYPNSQYAGNAQYWLGEVNLAKGDLQGAGQAFAKVSQLYPKHAKVPDSLYKLADV
ERRLGHTDKVKGILQQVVSQYPGTSAAQLAQRDLQRM