Protein Info for AO353_03525 in Pseudomonas fluorescens FW300-N2E3

Annotation: quinolinate synthase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00550: quinolinate synthetase complex, A subunit
  • amino acids 30 to 341 (312 residues), 360.4 bits, E=3.9e-112
• PF02445: NadA
  • amino acids 34 to 339 (306 residues), 347.2 bits, E=3.6e-108

Best Hits

Swiss-Prot: 96% identical to NADA_PSEPF: Quinolinate synthase A (nadA) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03517, quinolinate synthase [EC: 2.5.1.72] (inferred from 96% identity to pfo:Pfl01_4397)

MetaCyc: 67% identical to quinolinate synthase (Escherichia coli K-12 substr. MG1655)
Quinolinate synthase. [EC: 2.5.1.72]

Predicted SEED Role

"Quinolinate synthetase (EC 2.5.1.72)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.5.1.72)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• NAD de novo biosynthesis I (5/6 steps found)
• NAD de novo biosynthesis III (5/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
• nicotine biosynthesis (3/9 steps found)
• superpathway of nicotine biosynthesis (4/12 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.72

Sequence Analysis Tools

See A0A0N9WB94 at UniProt or InterPro

Protein Sequence (352 amino acids)

>AO353_03525 quinolinate synthase A (Pseudomonas fluorescens FW300-N2E3)
MTQISERLLVQAHLDAKQPKPLSAEEQAHYRAAIAAELKAQDAVLVAHFYCDPIIQALAE
ETGGCVSDSLEMARFGNAHPAKTVVVAGVKFMGETAKILNPEKRVLMPTLEATCSLDLGC
PVDEFSAFCDQHPERTVVVYANTSAAVKARADWVVTSSCALEIVESLMDNGETIIWGPDK
HLGTYIQRKTGADMLLWDGACIVHEEFKAKQLEDMKALYPDAAILVHPESPTAVIELADA
VGSTSQLIAAAQSLPNKTLIVATDRGIFYKMQQLCPDKVFIEAPTAGNGAACRSCAHCPW
MAMNTLERTLQCLREGSGEIFVEPALIPQAIRPLKRMLDFTAAARMKLAGNA