Protein Info for AO353_03495 in Pseudomonas fluorescens FW300-N2E3

Annotation: glycine cleavage system protein H

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00527: glycine cleavage system H protein
  • amino acids 3 to 123 (121 residues), 141.9 bits, E=5.8e-46
• PF01597: GCV_H
  • amino acids 4 to 122 (119 residues), 133.1 bits, E=2.5e-43

Best Hits

Swiss-Prot: 82% identical to GCSH1_PSEPK: Glycine cleavage system H protein 1 (gcvH1) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K02437, glycine cleavage system H protein (inferred from 91% identity to pfo:Pfl01_4391)

MetaCyc: 51% identical to glycine cleavage system H protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Glycine cleavage system H protein" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle)

MetaCyc Pathways

• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)

Sequence Analysis Tools

See A0A0N9VQC1 at UniProt or InterPro

Protein Sequence (127 amino acids)

>AO353_03495 glycine cleavage system protein H (Pseudomonas fluorescens FW300-N2E3)
MSELRFTEDHEWLRTEADGSVTVGITAFAQNALGDVVFVQLPELQSYEQGAEAATVESVK
AASGVYMPLDGDVLEVNPALDSSPELVNEDPLGEGWFFRFKPTDASAVAKLLDQNAYDRL
IKANAEA