Protein Info for AO353_03480 in Pseudomonas fluorescens FW300-N2E3

Annotation: carbamate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00696: AA_kinase
  • amino acids 1 to 281 (281 residues), 75.4 bits, E=2.9e-25
• TIGR00746: carbamate kinase
  • amino acids 1 to 300 (300 residues), 423.3 bits, E=2.5e-131

Best Hits

Swiss-Prot: 80% identical to ARCC_PSEAE: Carbamate kinase (arcC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00926, carbamate kinase [EC: 2.7.2.2] (inferred from 92% identity to pba:PSEBR_a1196)

Predicted SEED Role

"Carbamate kinase (EC 2.7.2.2)" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or MLST or Polyamine Metabolism (EC 2.7.2.2)

MetaCyc Pathways

• L-arginine degradation V (arginine deiminase pathway) (4/4 steps found)
• L-citrulline degradation (3/3 steps found)
• allantoin degradation IV (anaerobic) (2/9 steps found)
• guadinomine B biosynthesis (2/13 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Glutamate metabolism
• Nitrogen metabolism
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.2

Sequence Analysis Tools

See A0A0N9WDY0 at UniProt or InterPro

Protein Sequence (309 amino acids)

>AO353_03480 carbamate kinase (Pseudomonas fluorescens FW300-N2E3)
MRIVIALGGNALLRRGEPMTADNQRGNIRVATEQIAKIHPGNQLVIAHGNGPQIGLLSLQ
AAAYTSVSPYPLDVLGAETDGMIGYIIEQELGNLLDFEVPFATLLTQVEVDPNDPAFQHP
SKPIGPVYSKAEAEKLAAEKGWAIAPDGDKFRRVVASPKPKRIFEIRPVKWLLEKGSIVI
CAGGGGIPTMYDEHRKLKGVEAVIDKDLCSALLAEQLESDLLVIATDVNAAFIDFGKPTQ
KAIARAHPDDIEKLDFAAGSMGPKVQAACEFARNTGKVAVIGSLSDIEAIVQGRAGTRIS
TAEPGITYL